Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 97885..98411 | Replicon | plasmid pTMTA97341 |
Accession | NZ_AP025335 | ||
Organism | Phytobacter diazotrophicus strain TA9734 |
Toxin (Protein)
Gene name | relE | Uniprot ID | S1EXL1 |
Locus tag | L6445_RS27930 | Protein ID | WP_000323025.1 |
Coordinates | 98124..98411 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | J5W3H0 |
Locus tag | L6445_RS27925 | Protein ID | WP_004196370.1 |
Coordinates | 97885..98124 (+) | Length | 80 a.a. |
Genomic Context
Location: 93444..94421 (978 bp)
Type: Others
Protein ID: WP_004196334.1
Type: Others
Protein ID: WP_004196334.1
Location: 94378..95754 (1377 bp)
Type: Others
Protein ID: WP_004196363.1
Type: Others
Protein ID: WP_004196363.1
Location: 97885..98124 (240 bp)
Type: Antitoxin
Protein ID: WP_004196370.1
Type: Antitoxin
Protein ID: WP_004196370.1
Location: 98124..98411 (288 bp)
Type: Toxin
Protein ID: WP_000323025.1
Type: Toxin
Protein ID: WP_000323025.1
Location: 98516..98641 (126 bp)
Type: Others
Protein ID: WP_223540704.1
Type: Others
Protein ID: WP_223540704.1
Location: 99667..100245 (579 bp)
Type: Others
Protein ID: WP_125125756.1
Type: Others
Protein ID: WP_125125756.1
Location: 100317..100619 (303 bp)
Type: Others
Protein ID: WP_125125757.1
Type: Others
Protein ID: WP_125125757.1
Location: 101345..101647 (303 bp)
Type: Others
Protein ID: WP_047368814.1
Type: Others
Protein ID: WP_047368814.1
Location: 101661..102479 (819 bp)
Type: Others
Protein ID: WP_172600722.1
Type: Others
Protein ID: WP_172600722.1
Location: 93222..93414 (193 bp)
Type: Others
Protein ID: Protein_102
Type: Others
Protein ID: Protein_102
Location: 95785..96474 (690 bp)
Type: Others
Protein ID: WP_004196322.1
Type: Others
Protein ID: WP_004196322.1
Location: 96488..97225 (738 bp)
Type: Others
Protein ID: WP_008460272.1
Type: Others
Protein ID: WP_008460272.1
Location: 97269..97634 (366 bp)
Type: Others
Protein ID: WP_009651956.1
Type: Others
Protein ID: WP_009651956.1
Location: 97762..97860 (99 bp)
Type: Others
Protein ID: Protein_108
Type: Others
Protein ID: Protein_108
Location: 98846..99100 (255 bp)
Type: Others
Protein ID: WP_125125755.1
Type: Others
Protein ID: WP_125125755.1
Location: 102496..103041 (546 bp)
Type: Others
Protein ID: WP_125125759.1
Type: Others
Protein ID: WP_125125759.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
L6445_RS27890 | 93222..93414 | - | 193 | Protein_102 | MFS transporter | - |
L6445_RS27895 (PDTA9734_55170) | 93444..94421 | + | 978 | WP_004196334.1 | chromate resistance protein | - |
L6445_RS27900 (PDTA9734_55180) | 94378..95754 | + | 1377 | WP_004196363.1 | chromate efflux transporter | - |
L6445_RS27905 (PDTA9734_55190) | 95785..96474 | - | 690 | WP_004196322.1 | hypothetical protein | - |
L6445_RS27910 (PDTA9734_55200) | 96488..97225 | - | 738 | WP_008460272.1 | HupE/UreJ family protein | - |
L6445_RS27915 (PDTA9734_55210) | 97269..97634 | - | 366 | WP_009651956.1 | hypothetical protein | - |
L6445_RS27920 | 97762..97860 | - | 99 | Protein_108 | protein YdfV | - |
L6445_RS27925 (PDTA9734_55220) | 97885..98124 | + | 240 | WP_004196370.1 | type II toxin-antitoxin system antitoxin RelB | Antitoxin |
L6445_RS27930 (PDTA9734_55230) | 98124..98411 | + | 288 | WP_000323025.1 | type II toxin-antitoxin system mRNA interferase RelE | Toxin |
L6445_RS27940 (PDTA9734_55240) | 98516..98641 | + | 126 | WP_223540704.1 | type I toxin-antitoxin system Hok family toxin | - |
L6445_RS27945 (PDTA9734_55250) | 98846..99100 | - | 255 | WP_125125755.1 | DUF2767 family protein | - |
L6445_RS27950 (PDTA9734_55260) | 99667..100245 | + | 579 | WP_125125756.1 | hypothetical protein | - |
L6445_RS27955 (PDTA9734_55270) | 100317..100619 | + | 303 | WP_125125757.1 | hypothetical protein | - |
L6445_RS27960 (PDTA9734_55280) | 101345..101647 | + | 303 | WP_047368814.1 | hypothetical protein | - |
L6445_RS27965 (PDTA9734_55290) | 101661..102479 | + | 819 | WP_172600722.1 | DUF932 domain-containing protein | - |
L6445_RS27970 (PDTA9734_55300) | 102496..103041 | - | 546 | WP_125125759.1 | lytic transglycosylase domain-containing protein | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..174856 | 174856 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11225.22 Da Isoelectric Point: 10.1967
>T40272 WP_000323025.1 NZ_AP025335:98124-98411 [Phytobacter diazotrophicus]
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
MAYFLDFDERALKEWRKLGSTVREQLKKKLVEVLESPRIEANKLRGMPDCYKIKLRSSGYRLVYQVIDEKVVVFVISVGK
RERSEVYSEAVKRIL
Download Length: 288 bp
>T40272 NZ_AP025335:98124-98411 [Phytobacter diazotrophicus]
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
Antitoxin
Download Length: 80 a.a. Molecular weight: 9018.43 Da Isoelectric Point: 4.3894
>AT40272 WP_004196370.1 NZ_AP025335:97885-98124 [Phytobacter diazotrophicus]
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLCNPKPVRVTLDEL
MGSINLRIDDELKARSYAALEKMGVTPSEALRLMLEYIADNERLPFKQTLLSDEDAELVEIVKERLCNPKPVRVTLDEL
Download Length: 240 bp
>AT40272 NZ_AP025335:97885-98124 [Phytobacter diazotrophicus]
ATGGGTAGCATTAACCTACGTATTGACGATGAACTTAAAGCGCGTTCTTACGCCGCGCTTGAAAAAATGGGCGTAACTCC
TTCTGAAGCGCTTCGTCTCATGCTCGAGTATATCGCTGACAATGAACGCTTGCCGTTCAAACAGACACTCCTGAGTGATG
AAGATGCTGAACTTGTGGAGATAGTGAAAGAACGACTTTGTAATCCTAAGCCAGTACGTGTGACGCTGGATGAACTCTGA
ATGGGTAGCATTAACCTACGTATTGACGATGAACTTAAAGCGCGTTCTTACGCCGCGCTTGAAAAAATGGGCGTAACTCC
TTCTGAAGCGCTTCGTCTCATGCTCGAGTATATCGCTGACAATGAACGCTTGCCGTTCAAACAGACACTCCTGAGTGATG
AAGATGCTGAACTTGTGGAGATAGTGAAAGAACGACTTTGTAATCCTAAGCCAGTACGTGTGACGCTGGATGAACTCTGA