Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | mazEF/PemK-MazE |
Location | 8028..8572 | Replicon | plasmid pTH1 |
Accession | NZ_AP018559 | ||
Organism | Hydrogenophilus thermoluteolus strain TH-1 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | HPTL_RS10845 | Protein ID | WP_179949102.1 |
Coordinates | 8028..8354 (-) | Length | 109 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | - |
Locus tag | HPTL_RS10850 | Protein ID | WP_119336199.1 |
Coordinates | 8351..8572 (-) | Length | 74 a.a. |
Genomic Context
Location: 3611..3850 (240 bp)
Type: Others
Protein ID: WP_145981821.1
Type: Others
Protein ID: WP_145981821.1
Location: 7519..7662 (144 bp)
Type: Others
Protein ID: Protein_10
Type: Others
Protein ID: Protein_10
Location: 10829..11242 (414 bp)
Type: Others
Protein ID: WP_119336202.1
Type: Others
Protein ID: WP_119336202.1
Location: 11196..11516 (321 bp)
Type: Others
Protein ID: WP_119336203.1
Type: Others
Protein ID: WP_119336203.1
Location: 12603..12770 (168 bp)
Type: Others
Protein ID: WP_179949104.1
Type: Others
Protein ID: WP_179949104.1
Location: 12812..13048 (237 bp)
Type: Others
Protein ID: WP_119336204.1
Type: Others
Protein ID: WP_119336204.1
Location: 13045..13476 (432 bp)
Type: Others
Protein ID: WP_119336205.1
Type: Others
Protein ID: WP_119336205.1
Location: 3980..4306 (327 bp)
Type: Others
Protein ID: WP_119336194.1
Type: Others
Protein ID: WP_119336194.1
Location: 4293..4523 (231 bp)
Type: Others
Protein ID: WP_119336195.1
Type: Others
Protein ID: WP_119336195.1
Location: 4597..6261 (1665 bp)
Type: Others
Protein ID: WP_119336196.1
Type: Others
Protein ID: WP_119336196.1
Location: 6251..6634 (384 bp)
Type: Others
Protein ID: WP_119336197.1
Type: Others
Protein ID: WP_119336197.1
Location: 7670..7921 (252 bp)
Type: Others
Protein ID: WP_119336198.1
Type: Others
Protein ID: WP_119336198.1
Location: 8028..8354 (327 bp)
Type: Toxin
Protein ID: WP_179949102.1
Type: Toxin
Protein ID: WP_179949102.1
Location: 8351..8572 (222 bp)
Type: Antitoxin
Protein ID: WP_119336199.1
Type: Antitoxin
Protein ID: WP_119336199.1
Location: 8729..10003 (1275 bp)
Type: Others
Protein ID: WP_119336200.1
Type: Others
Protein ID: WP_119336200.1
Location: 9997..10626 (630 bp)
Type: Others
Protein ID: WP_119336201.1
Type: Others
Protein ID: WP_119336201.1
Location: 11629..12159 (531 bp)
Type: Others
Protein ID: WP_179949103.1
Type: Others
Protein ID: WP_179949103.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
HPTL_RS11225 | 3611..3850 | + | 240 | WP_145981821.1 | hypothetical protein | - |
HPTL_RS10820 | 3980..4306 | - | 327 | WP_119336194.1 | type II toxin-antitoxin system PemK/MazF family toxin | - |
HPTL_RS10825 | 4293..4523 | - | 231 | WP_119336195.1 | addiction module antitoxin | - |
HPTL_RS10830 | 4597..6261 | - | 1665 | WP_119336196.1 | relaxase/mobilization nuclease domain-containing protein | - |
HPTL_RS10835 | 6251..6634 | - | 384 | WP_119336197.1 | plasmid mobilization relaxosome protein MobC | - |
HPTL_RS11310 | 7519..7662 | + | 144 | Protein_10 | ATP-binding protein | - |
HPTL_RS10840 | 7670..7921 | - | 252 | WP_119336198.1 | hypothetical protein | - |
HPTL_RS10845 | 8028..8354 | - | 327 | WP_179949102.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
HPTL_RS10850 | 8351..8572 | - | 222 | WP_119336199.1 | antitoxin MazE family protein | Antitoxin |
HPTL_RS10855 | 8729..10003 | - | 1275 | WP_119336200.1 | transposase | - |
HPTL_RS10860 | 9997..10626 | - | 630 | WP_119336201.1 | IS607 family transposase | - |
HPTL_RS10865 | 10829..11242 | + | 414 | WP_119336202.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
HPTL_RS10870 | 11196..11516 | + | 321 | WP_119336203.1 | DNA-binding transcriptional regulator | - |
HPTL_RS11340 | 11629..12159 | - | 531 | WP_179949103.1 | hypothetical protein | - |
HPTL_RS10885 | 12603..12770 | + | 168 | WP_179949104.1 | hypothetical protein | - |
HPTL_RS10890 | 12812..13048 | + | 237 | WP_119336204.1 | ribbon-helix-helix protein, CopG family | - |
HPTL_RS10895 | 13045..13476 | + | 432 | WP_119336205.1 | putative toxin-antitoxin system toxin component, PIN family | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | ureB / ureA | 1..65637 | 65637 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 109 a.a. Molecular weight: 11893.00 Da Isoelectric Point: 9.2935
>T31889 WP_179949102.1 NZ_AP018559:c8354-8028 [Hydrogenophilus thermoluteolus]
MMRGDLVTIVTQGDFGKPRPALVIQSDLFNELSSITVFPVTSTIVDAPLLRVTVEPTPENGLHKRSQVMVDKIMTVRRDK
VGQIIGRIDTTTLTTIERCLAVFLGIAK
MMRGDLVTIVTQGDFGKPRPALVIQSDLFNELSSITVFPVTSTIVDAPLLRVTVEPTPENGLHKRSQVMVDKIMTVRRDK
VGQIIGRIDTTTLTTIERCLAVFLGIAK
Download Length: 327 bp
>T31889 NZ_AP018559:c8354-8028 [Hydrogenophilus thermoluteolus]
ATGATGCGCGGCGATTTGGTAACGATCGTTACCCAGGGCGACTTTGGCAAACCAAGGCCAGCGTTGGTGATCCAGTCCGA
TCTGTTCAACGAGCTCAGCAGCATAACCGTCTTTCCTGTAACCAGTACCATTGTGGATGCCCCGTTGTTGCGCGTCACGG
TTGAGCCAACCCCGGAAAACGGCTTGCACAAGCGATCACAGGTGATGGTGGACAAAATTATGACCGTGCGGCGGGACAAA
GTCGGTCAGATCATTGGACGTATCGATACGACTACGCTGACAACGATCGAGCGCTGCTTAGCTGTCTTCTTGGGAATCGC
GAAATAA
ATGATGCGCGGCGATTTGGTAACGATCGTTACCCAGGGCGACTTTGGCAAACCAAGGCCAGCGTTGGTGATCCAGTCCGA
TCTGTTCAACGAGCTCAGCAGCATAACCGTCTTTCCTGTAACCAGTACCATTGTGGATGCCCCGTTGTTGCGCGTCACGG
TTGAGCCAACCCCGGAAAACGGCTTGCACAAGCGATCACAGGTGATGGTGGACAAAATTATGACCGTGCGGCGGGACAAA
GTCGGTCAGATCATTGGACGTATCGATACGACTACGCTGACAACGATCGAGCGCTGCTTAGCTGTCTTCTTGGGAATCGC
GAAATAA
Antitoxin
Download Length: 74 a.a. Molecular weight: 8394.66 Da Isoelectric Point: 9.3851
>AT31889 WP_119336199.1 NZ_AP018559:c8572-8351 [Hydrogenophilus thermoluteolus]
MTVPVKARVQKYRDALRRSGLRPVQIWVPDTRRPGFAQECRRQCLLVTQADAADTQLQRLMDEALAEIDGWQA
MTVPVKARVQKYRDALRRSGLRPVQIWVPDTRRPGFAQECRRQCLLVTQADAADTQLQRLMDEALAEIDGWQA
Download Length: 222 bp
>AT31889 NZ_AP018559:c8572-8351 [Hydrogenophilus thermoluteolus]
ATGACAGTACCGGTCAAAGCGCGTGTTCAAAAGTATCGCGACGCGCTGCGCCGCTCGGGTTTGCGTCCGGTTCAGATCTG
GGTACCGGATACCCGCCGCCCGGGCTTTGCACAAGAGTGTCGCCGCCAGTGCCTGCTCGTGACCCAGGCAGACGCCGCTG
ATACGCAACTCCAACGACTCATGGATGAAGCCTTGGCAGAGATTGATGGCTGGCAGGCATGA
ATGACAGTACCGGTCAAAGCGCGTGTTCAAAAGTATCGCGACGCGCTGCGCCGCTCGGGTTTGCGTCCGGTTCAGATCTG
GGTACCGGATACCCGCCGCCCGGGCTTTGCACAAGAGTGTCGCCGCCAGTGCCTGCTCGTGACCCAGGCAGACGCCGCTG
ATACGCAACTCCAACGACTCATGGATGAAGCCTTGGCAGAGATTGATGGCTGGCAGGCATGA