Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 1550293..1550625 | Replicon | chromosome |
| Accession | NZ_AP012547 | ||
| Organism | Sulfuritalea hydrogenivorans sk43H strain DSM 22779 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | - |
| Locus tag | SUTH_RS19865 | Protein ID | WP_197539665.1 |
| Coordinates | 1550506..1550625 (+) | Length | 40 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | SUTH_RS18995 | Protein ID | WP_084207297.1 |
| Coordinates | 1550293..1550502 (+) | Length | 70 a.a. |
Genomic Context
Location: 1547191..1548417 (1227 bp)
Type: Others
Protein ID: WP_041101949.1
Type: Others
Protein ID: WP_041101949.1
Location: 1548407..1548859 (453 bp)
Type: Others
Protein ID: WP_041098311.1
Type: Others
Protein ID: WP_041098311.1
Location: 1548856..1550166 (1311 bp)
Type: Others
Protein ID: WP_041098312.1
Type: Others
Protein ID: WP_041098312.1
Location: 1550293..1550502 (210 bp)
Type: Antitoxin
Protein ID: WP_084207297.1
Type: Antitoxin
Protein ID: WP_084207297.1
Location: 1550506..1550625 (120 bp)
Type: Toxin
Protein ID: WP_197539665.1
Type: Toxin
Protein ID: WP_197539665.1
Location: 1550767..1551267 (501 bp)
Type: Others
Protein ID: WP_084207298.1
Type: Others
Protein ID: WP_084207298.1
Location: 1551387..1552811 (1425 bp)
Type: Others
Protein ID: WP_041098315.1
Type: Others
Protein ID: WP_041098315.1
Location: 1546645..1547025 (381 bp)
Type: Others
Protein ID: WP_041098309.1
Type: Others
Protein ID: WP_041098309.1
Location: 1552869..1553006 (138 bp)
Type: Others
Protein ID: WP_171817332.1
Type: Others
Protein ID: WP_171817332.1
Location: 1553086..1555464 (2379 bp)
Type: Others
Protein ID: WP_041101951.1
Type: Others
Protein ID: WP_041101951.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| SUTH_RS07515 | 1546645..1547025 | - | 381 | WP_041098309.1 | Mth938-like domain-containing protein | - |
| SUTH_RS07520 | 1547191..1548417 | + | 1227 | WP_041101949.1 | pyridoxal phosphate-dependent aminotransferase | - |
| SUTH_RS07525 | 1548407..1548859 | + | 453 | WP_041098311.1 | GNAT family N-acetyltransferase | - |
| SUTH_RS07530 | 1548856..1550166 | + | 1311 | WP_041098312.1 | homoserine dehydrogenase | - |
| SUTH_RS18995 | 1550293..1550502 | + | 210 | WP_084207297.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| SUTH_RS19865 | 1550506..1550625 | + | 120 | WP_197539665.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| SUTH_RS07540 | 1550767..1551267 | + | 501 | WP_084207298.1 | hypothetical protein | - |
| SUTH_RS07545 | 1551387..1552811 | + | 1425 | WP_041098315.1 | threonine synthase | - |
| SUTH_RS19620 | 1552869..1553006 | - | 138 | WP_171817332.1 | hypothetical protein | - |
| SUTH_RS07550 | 1553086..1555464 | - | 2379 | WP_041101951.1 | DNA topoisomerase IV subunit A | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| No matching records found | |||||||
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 40 a.a. Molecular weight: 4414.16 Da Isoelectric Point: 11.9644
>T30566 WP_197539665.1 NZ_AP012547:1550506-1550625 [Sulfuritalea hydrogenivorans sk43H]
MGNVPVLKPHEVIAILVRLGFTEVRQRGSHKQFRDTAGR
MGNVPVLKPHEVIAILVRLGFTEVRQRGSHKQFRDTAGR
Download Length: 120 bp
>T30566 NZ_AP012547:1550506-1550625 [Sulfuritalea hydrogenivorans sk43H]
ATGGGAAATGTTCCGGTCCTCAAACCCCATGAAGTCATTGCCATTCTTGTCAGGCTCGGATTTACTGAAGTCCGCCAACG
CGGCTCGCACAAACAATTCCGCGATACCGCTGGCCGCTAA
ATGGGAAATGTTCCGGTCCTCAAACCCCATGAAGTCATTGCCATTCTTGTCAGGCTCGGATTTACTGAAGTCCGCCAACG
CGGCTCGCACAAACAATTCCGCGATACCGCTGGCCGCTAA
Antitoxin
Download Length: 70 a.a. Molecular weight: 7457.45 Da Isoelectric Point: 4.0818
>AT30566 WP_084207297.1 NZ_AP012547:1550293-1550502 [Sulfuritalea hydrogenivorans sk43H]
MRVYSAVIERCAQTGLFVGFVPGFPGAHSQGETLDELNHNLHDVIAMLLEDGEPMLESEFVGVQNVAVA
MRVYSAVIERCAQTGLFVGFVPGFPGAHSQGETLDELNHNLHDVIAMLLEDGEPMLESEFVGVQNVAVA
Download Length: 210 bp
>AT30566 NZ_AP012547:1550293-1550502 [Sulfuritalea hydrogenivorans sk43H]
ATGAGAGTCTATTCAGCGGTAATTGAACGGTGCGCACAAACCGGCCTGTTCGTTGGTTTCGTTCCCGGCTTTCCTGGCGC
GCATTCCCAGGGCGAAACGCTGGATGAACTCAACCACAACCTGCACGACGTAATTGCAATGCTTCTGGAGGATGGCGAAC
CCATGCTGGAGTCGGAGTTTGTCGGGGTTCAAAACGTTGCCGTAGCTTGA
ATGAGAGTCTATTCAGCGGTAATTGAACGGTGCGCACAAACCGGCCTGTTCGTTGGTTTCGTTCCCGGCTTTCCTGGCGC
GCATTCCCAGGGCGAAACGCTGGATGAACTCAACCACAACCTGCACGACGTAATTGCAATGCTTCTGGAGGATGGCGAAC
CCATGCTGGAGTCGGAGTTTGTCGGGGTTCAAAACGTTGCCGTAGCTTGA