Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) relBE/ParE-DnaT
Location 87623..88145 Replicon plasmid P2
Accession NZ_OY019090
Organism Escherichia coli O25b:H4-ST131 isolate 42

Toxin (Protein)


Gene name relE Uniprot ID S1PVW2
Locus tag QU406_RS26860 Protein ID WP_001681795.1
Coordinates 87864..88145 (+) Length 94 a.a.

Antitoxin (Protein)


Gene name relB Uniprot ID S1Q9V6
Locus tag QU406_RS26855 Protein ID WP_001681796.1
Coordinates 87623..87874 (+) Length 84 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QU406_RS26830 83039..83689 - 651 WP_001532121.1 A24 family peptidase -
QU406_RS26835 83706..84188 - 483 WP_021561187.1 lytic transglycosylase domain-containing protein -
QU406_RS26840 84236..84772 - 537 WP_001011500.1 type 4 pilus major pilin -
QU406_RS26845 84822..85922 - 1101 WP_001211427.1 type II secretion system F family protein -
QU406_RS26850 85924..87432 - 1509 WP_012605185.1 ATPase, T2SS/T4P/T4SS family -
QU406_RS26855 87623..87874 + 252 WP_001681796.1 hypothetical protein Antitoxin
QU406_RS26860 87864..88145 + 282 WP_001681795.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QU406_RS26865 88455..88907 - 453 WP_016238167.1 type IV pilus biogenesis protein PilP -
QU406_RS26870 88897..90192 - 1296 WP_032325932.1 type 4b pilus protein PilO2 -
QU406_RS26875 90213..91832 - 1620 WP_042014174.1 PilN family type IVB pilus formation outer membrane protein -
QU406_RS26880 91863..92300 - 438 WP_001681791.1 type IV pilus biogenesis protein PilM -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid - - 1..100743 100743


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(4-86)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 94 a.a.        Molecular weight: 11122.01 Da        Isoelectric Point: 10.6249

>T297228 WP_001681795.1 NZ_OY019090:87864-88145 [Escherichia coli O25b:H4-ST131]
MTYELEFERRALKEWHKLGHTVREQFKKKLSERLKNPRVPAARLHGHTDRYKIKLRASGYRLVYQVIDEKIVLLVIAVGK
RESSEVYQMADIR

Download         Length: 282 bp

Antitoxin


Download         Length: 84 a.a.        Molecular weight: 9124.33 Da        Isoelectric Point: 4.0610

>AT297228 WP_001681796.1 NZ_OY019090:87623-87874 [Escherichia coli O25b:H4-ST131]
MSYQILTTTAASITELKKNPMGTVAEGEGGAVAILNRNEPAFYCVPPELYAYYRELAEDAELNAIADERMKNPDIVKVSL
DDL

Download         Length: 252 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PVW2

Antitoxin

Source ID Structure
AlphaFold DB S1Q9V6

References