Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 157134..157777 | Replicon | plasmid P1 |
| Accession | NZ_OY019089 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | V0UN72 |
| Locus tag | QU406_RS26310 | Protein ID | WP_001034044.1 |
| Coordinates | 157361..157777 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | B1P7N7 |
| Locus tag | QU406_RS26305 | Protein ID | WP_001261286.1 |
| Coordinates | 157134..157364 (+) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS26285 (153765) | 153765..154520 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QU406_RS26290 (155242) | 155242..156048 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QU406_RS26295 (156049) | 156049..156354 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | - |
| QU406_RS26300 (156356) | 156356..156574 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | - |
| QU406_RS26305 (157134) | 157134..157364 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| QU406_RS26310 (157361) | 157361..157777 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| QU406_RS26315 (157852) | 157852..159411 | + | 1560 | Protein_192 | AAA family ATPase | - |
| QU406_RS26325 (160181) | 160181..160821 | + | 641 | Protein_194 | NADPH-dependent L-lysine N(6)-monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iucD / iutA | 1..168227 | 168227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15232.66 Da Isoelectric Point: 6.8536
>T297226 WP_001034044.1 NZ_OY019089:157361-157777 [Escherichia coli O25b:H4-ST131]
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
VNKIYMLDTNICSFIMREQPEALLKHLEQSVLRGHRIVVSAITYSEMRFGATGPKASPRHVQLVDAFCERLDAVLPWDRA
AVDATTEIKVALRLAGTPIGPNDTAIAGHAIAACAILVTNNVREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CHW1 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CKZ6 |