Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 156049..156574 | Replicon | plasmid P1 |
| Accession | NZ_OY019089 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | S1PFV8 |
| Locus tag | QU406_RS26295 | Protein ID | WP_001159871.1 |
| Coordinates | 156049..156354 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | H9TJP1 |
| Locus tag | QU406_RS26300 | Protein ID | WP_000813630.1 |
| Coordinates | 156356..156574 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS26280 (152011) | 152011..153177 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QU406_RS26285 (153765) | 153765..154520 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QU406_RS26290 (155242) | 155242..156048 | - | 807 | WP_000016970.1 | site-specific integrase | - |
| QU406_RS26295 (156049) | 156049..156354 | - | 306 | WP_001159871.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QU406_RS26300 (156356) | 156356..156574 | - | 219 | WP_000813630.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QU406_RS26305 (157134) | 157134..157364 | + | 231 | WP_001261286.1 | type II toxin-antitoxin system VapB family antitoxin | - |
| QU406_RS26310 (157361) | 157361..157777 | + | 417 | WP_001034044.1 | type II toxin-antitoxin system VapC family toxin | - |
| QU406_RS26315 (157852) | 157852..159411 | + | 1560 | Protein_192 | AAA family ATPase | - |
| QU406_RS26325 (160181) | 160181..160821 | + | 641 | Protein_194 | NADPH-dependent L-lysine N(6)-monooxygenase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / tet(A) | senB / iucD / iutA | 1..168227 | 168227 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11692.49 Da Isoelectric Point: 6.4674
>T297225 WP_001159871.1 NZ_OY019089:c156354-156049 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CCE8 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829CEF5 |