Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 156049..156574 Replicon plasmid P1
Accession NZ_OY019089
Organism Escherichia coli O25b:H4-ST131 isolate 42

Toxin (Protein)


Gene name ccdB Uniprot ID S1PFV8
Locus tag QU406_RS26295 Protein ID WP_001159871.1
Coordinates 156049..156354 (-) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID H9TJP1
Locus tag QU406_RS26300 Protein ID WP_000813630.1
Coordinates 156356..156574 (-) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QU406_RS26280 (152011) 152011..153177 - 1167 WP_000772446.1 plasmid-partitioning protein SopA -
QU406_RS26285 (153765) 153765..154520 - 756 WP_000852146.1 replication initiation protein RepE -
QU406_RS26290 (155242) 155242..156048 - 807 WP_000016970.1 site-specific integrase -
QU406_RS26295 (156049) 156049..156354 - 306 WP_001159871.1 type II toxin-antitoxin system toxin CcdB Toxin
QU406_RS26300 (156356) 156356..156574 - 219 WP_000813630.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
QU406_RS26305 (157134) 157134..157364 + 231 WP_001261286.1 type II toxin-antitoxin system VapB family antitoxin -
QU406_RS26310 (157361) 157361..157777 + 417 WP_001034044.1 type II toxin-antitoxin system VapC family toxin -
QU406_RS26315 (157852) 157852..159411 + 1560 Protein_192 AAA family ATPase -
QU406_RS26325 (160181) 160181..160821 + 641 Protein_194 NADPH-dependent L-lysine N(6)-monooxygenase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / tet(A) senB / iucD / iutA 1..168227 168227


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11692.49 Da        Isoelectric Point: 6.4674

>T297225 WP_001159871.1 NZ_OY019089:c156354-156049 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHVGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8354.27 Da        Isoelectric Point: 4.5203

>AT297225 WP_000813630.1 NZ_OY019089:c156574-156356 [Escherichia coli O25b:H4-ST131]
MKQRITVTVDSDSYQLLKAYDVNISGLVSTTLQNEARRLRAERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829CCE8

Antitoxin

Source ID Structure
AlphaFold DB A0A829CEF5

References