Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3766745..3767265 Replicon chromosome
Accession NZ_OY019088
Organism Escherichia coli O25b:H4-ST131 isolate 42

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QU406_RS18300 Protein ID WP_001160964.1
Coordinates 3766981..3767265 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QU406_RS18295 Protein ID WP_000125566.1
Coordinates 3766745..3766978 (+) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QU406_RS18270 (3761818) 3761818..3762105 + 288 WP_000203744.1 ferredoxin-like protein FixX -
QU406_RS18275 (3762164) 3762164..3763495 + 1332 WP_001183209.1 MFS transporter -
QU406_RS18280 (3763603) 3763603..3764133 + 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QU406_RS18285 (3764126) 3764126..3765988 + 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QU406_RS18290 (3766180) 3766180..3766659 + 480 WP_000624375.1 type 3 dihydrofolate reductase -
QU406_RS18295 (3766745) 3766745..3766978 + 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QU406_RS18300 (3766981) 3766981..3767265 + 285 WP_001160964.1 CcdB family protein Toxin
QU406_RS18305 (3767292) 3767292..3768140 - 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QU406_RS18310 (3768147) 3768147..3768524 - 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QU406_RS18315 (3768527) 3768527..3769348 - 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QU406_RS18320 (3769345) 3769345..3770334 - 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QU406_RS18325 (3770334) 3770334..3771620 - 1287 WP_000800457.1 peptidylprolyl isomerase SurA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T297211 WP_001160964.1 NZ_OY019088:3766981-3767265 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT297211 WP_000125566.1 NZ_OY019088:3766745-3766978 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References