Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 3656704..3657280 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A061KXE4 |
| Locus tag | QU406_RS17770 | Protein ID | WP_001295743.1 |
| Coordinates | 3656704..3656991 (+) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A066STF6 |
| Locus tag | QU406_RS17775 | Protein ID | WP_000063148.1 |
| Coordinates | 3656978..3657280 (+) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS17755 (3652364) | 3652364..3653668 | - | 1305 | WP_000535012.1 | restriction endonuclease subunit S | - |
| QU406_RS17760 (3653658) | 3653658..3655277 | - | 1620 | WP_001029745.1 | class I SAM-dependent DNA methyltransferase | - |
| QU406_RS17765 (3655341) | 3655341..3656507 | - | 1167 | WP_000800831.1 | restriction endonuclease | - |
| QU406_RS17770 (3656704) | 3656704..3656991 | + | 288 | WP_001295743.1 | BrnT family toxin | Toxin |
| QU406_RS17775 (3656978) | 3656978..3657280 | + | 303 | WP_000063148.1 | BrnA antitoxin family protein | Antitoxin |
| QU406_RS17780 (3657314) | 3657314..3658270 | - | 957 | WP_001295745.1 | GTPase | - |
| QU406_RS17785 (3658281) | 3658281..3658484 | - | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| QU406_RS17790 (3658534) | 3658534..3660684 | - | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11156.62 Da Isoelectric Point: 7.4697
>T297210 WP_001295743.1 NZ_OY019088:3656704-3656991 [Escherichia coli O25b:H4-ST131]
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
MPMEFEWDANKAKSNRVKHGIRFEDAVLVFDDPQHLSQQDRIENGEYRWQTIGLVHGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A061KXE4 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A066STF6 |