Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3569531..3570366 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QU406_RS17345 | Protein ID | WP_000854759.1 |
| Coordinates | 3569989..3570366 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QU406_RS17340 | Protein ID | WP_001295723.1 |
| Coordinates | 3569531..3569899 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS17315 (3566646) | 3566646..3566841 | + | 196 | Protein_3382 | DUF905 family protein | - |
| QU406_RS17320 (3566959) | 3566959..3567777 | + | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QU406_RS17325 (3568119) | 3568119..3568592 | + | 474 | WP_001350782.1 | antirestriction protein | - |
| QU406_RS17330 (3568608) | 3568608..3569084 | + | 477 | WP_001186775.1 | RadC family protein | - |
| QU406_RS17335 (3569147) | 3569147..3569368 | + | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QU406_RS17340 (3569531) | 3569531..3569899 | + | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QU406_RS17345 (3569989) | 3569989..3570366 | + | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QU406_RS17350 (3570363) | 3570363..3570851 | + | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QU406_RS17355 (3570868) | 3570868..3571044 | + | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QU406_RS17360 (3571150) | 3571150..3571299 | + | 150 | Protein_3391 | hypothetical protein | - |
| QU406_RS17365 (3571758) | 3571758..3573299 | + | 1542 | WP_001298859.1 | IS21-like element ISEc12 family transposase | - |
| QU406_RS17370 (3573314) | 3573314..3574060 | + | 747 | WP_001016257.1 | IS21-like element ISEc12 family helper ATPase IstB | - |
| QU406_RS17375 (3574252) | 3574252..3574557 | + | 306 | Protein_3394 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 3555836..3585851 | 30015 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T297209 WP_000854759.1 NZ_OY019088:3569989-3570366 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT297209 WP_001295723.1 NZ_OY019088:3569531-3569899 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |