Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 3261206..3262007 Replicon chromosome
Accession NZ_OY019088
Organism Escherichia coli O25b:H4-ST131 isolate 42

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QU406_RS15780 Protein ID WP_001094436.1
Coordinates 3261206..3261583 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QU406_RS15785 Protein ID WP_015953067.1
Coordinates 3261630..3262007 (-) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QU406_RS15750 (3257165) 3257165..3257326 - 162 Protein_3074 DUF4942 domain-containing protein -
QU406_RS15755 (3257417) 3257417..3258916 + 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QU406_RS15760 (3258913) 3258913..3259668 + 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QU406_RS15765 (3259717) 3259717..3260427 - 711 WP_001621817.1 DUF4942 domain-containing protein -
QU406_RS15770 (3260512) 3260512..3260709 - 198 WP_000839254.1 DUF957 domain-containing protein -
QU406_RS15775 (3260721) 3260721..3261209 - 489 WP_000761714.1 DUF5983 family protein -
QU406_RS15780 (3261206) 3261206..3261583 - 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QU406_RS15785 (3261630) 3261630..3262007 - 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QU406_RS15790 (3262086) 3262086..3262307 - 222 WP_000692312.1 DUF987 domain-containing protein -
QU406_RS15795 (3262376) 3262376..3262852 - 477 WP_001186756.1 RadC family protein -
QU406_RS15800 (3262867) 3262867..3263352 - 486 WP_029700724.1 antirestriction protein -
QU406_RS15805 (3263444) 3263444..3264262 - 819 WP_001175163.1 DUF932 domain-containing protein -
QU406_RS15810 (3264352) 3264352..3264585 - 234 WP_001278287.1 DUF905 family protein -
QU406_RS15815 (3264591) 3264591..3265268 - 678 WP_001097301.1 hypothetical protein -
QU406_RS15820 (3265416) 3265416..3266096 - 681 WP_001282919.1 WYL domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T297207 WP_001094436.1 NZ_OY019088:c3261583-3261206 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT297207 WP_015953067.1 NZ_OY019088:c3262007-3261630 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References