Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3261206..3262007 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | D8EBK0 |
| Locus tag | QU406_RS15780 | Protein ID | WP_001094436.1 |
| Coordinates | 3261206..3261583 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MN76 |
| Locus tag | QU406_RS15785 | Protein ID | WP_015953067.1 |
| Coordinates | 3261630..3262007 (-) | Length | 126 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS15750 (3257165) | 3257165..3257326 | - | 162 | Protein_3074 | DUF4942 domain-containing protein | - |
| QU406_RS15755 (3257417) | 3257417..3258916 | + | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
| QU406_RS15760 (3258913) | 3258913..3259668 | + | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
| QU406_RS15765 (3259717) | 3259717..3260427 | - | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
| QU406_RS15770 (3260512) | 3260512..3260709 | - | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
| QU406_RS15775 (3260721) | 3260721..3261209 | - | 489 | WP_000761714.1 | DUF5983 family protein | - |
| QU406_RS15780 (3261206) | 3261206..3261583 | - | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
| QU406_RS15785 (3261630) | 3261630..3262007 | - | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
| QU406_RS15790 (3262086) | 3262086..3262307 | - | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
| QU406_RS15795 (3262376) | 3262376..3262852 | - | 477 | WP_001186756.1 | RadC family protein | - |
| QU406_RS15800 (3262867) | 3262867..3263352 | - | 486 | WP_029700724.1 | antirestriction protein | - |
| QU406_RS15805 (3263444) | 3263444..3264262 | - | 819 | WP_001175163.1 | DUF932 domain-containing protein | - |
| QU406_RS15810 (3264352) | 3264352..3264585 | - | 234 | WP_001278287.1 | DUF905 family protein | - |
| QU406_RS15815 (3264591) | 3264591..3265268 | - | 678 | WP_001097301.1 | hypothetical protein | - |
| QU406_RS15820 (3265416) | 3265416..3266096 | - | 681 | WP_001282919.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T297207 WP_001094436.1 NZ_OY019088:c3261583-3261206 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT297207 WP_015953067.1 NZ_OY019088:c3262007-3261630 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E2L1N0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A5Z3CIS0 |