Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 1911707..1912541 | Replicon | chromosome |
| Accession | NZ_OY019088 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 42 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | S1PLF5 |
| Locus tag | QU406_RS09365 | Protein ID | WP_000854690.1 |
| Coordinates | 1912164..1912541 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1P7N8 |
| Locus tag | QU406_RS09360 | Protein ID | WP_001305076.1 |
| Coordinates | 1911707..1912075 (+) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QU406_RS09320 (1906789) | 1906789..1907916 | + | 1128 | Protein_1828 | hypothetical protein | - |
| QU406_RS09325 (1907992) | 1907992..1908447 | + | 456 | WP_000581502.1 | IrmA family protein | - |
| QU406_RS09330 (1908526) | 1908526..1908759 | + | 234 | WP_000902034.1 | DUF905 family protein | - |
| QU406_RS09335 (1908860) | 1908860..1909678 | + | 819 | WP_001234620.1 | DUF932 domain-containing protein | - |
| QU406_RS09340 (1909733) | 1909733..1910218 | + | 486 | WP_000849565.1 | antirestriction protein | - |
| QU406_RS09345 (1910234) | 1910234..1910710 | + | 477 | WP_001186726.1 | RadC family protein | - |
| QU406_RS09350 (1910773) | 1910773..1910994 | + | 222 | WP_000692329.1 | DUF987 domain-containing protein | - |
| QU406_RS09355 (1911013) | 1911013..1911657 | + | 645 | WP_000094916.1 | hypothetical protein | - |
| QU406_RS09360 (1911707) | 1911707..1912075 | + | 369 | WP_001305076.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QU406_RS09365 (1912164) | 1912164..1912541 | + | 378 | WP_000854690.1 | TA system toxin CbtA family protein | Toxin |
| QU406_RS09370 (1912538) | 1912538..1913026 | + | 489 | WP_000761699.1 | DUF5983 family protein | - |
| QU406_RS09375 (1913043) | 1913043..1913240 | + | 198 | WP_000839293.1 | DUF957 domain-containing protein | - |
| QU406_RS09380 (1913325) | 1913325..1914170 | + | 846 | WP_001529401.1 | DUF4942 domain-containing protein | - |
| QU406_RS09385 (1914239) | 1914239..1914634 | + | 396 | WP_000208384.1 | DUF6088 family protein | - |
| QU406_RS09390 (1914627) | 1914627..1915560 | + | 934 | Protein_1842 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| QU406_RS09395 (1915977) | 1915977..1916147 | + | 171 | Protein_1843 | IS110 family transposase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | flank | IS/Tn | - | - | 1915992..1916147 | 155 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14057.04 Da Isoelectric Point: 9.1510
>T297201 WP_000854690.1 NZ_OY019088:1912164-1912541 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13560.39 Da Isoelectric Point: 4.7830
>AT297201 WP_001305076.1 NZ_OY019088:1911707-1912075 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|