Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 1766792..1767446 | Replicon | chromosome |
Accession | NZ_OY019088 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 42 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | QU406_RS08575 | Protein ID | WP_000244765.1 |
Coordinates | 1766792..1767199 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | QU406_RS08580 | Protein ID | WP_000354050.1 |
Coordinates | 1767180..1767446 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QU406_RS08555 (1762749) | 1762749..1764482 | - | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
QU406_RS08560 (1764488) | 1764488..1765198 | - | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QU406_RS08565 (1765223) | 1765223..1766119 | - | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QU406_RS08570 (1766231) | 1766231..1766752 | + | 522 | WP_001055874.1 | flavodoxin FldB | - |
QU406_RS08575 (1766792) | 1766792..1767199 | - | 408 | WP_000244765.1 | protein YgfX | Toxin |
QU406_RS08580 (1767180) | 1767180..1767446 | - | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
QU406_RS08585 (1767689) | 1767689..1768669 | + | 981 | WP_000886084.1 | tRNA-modifying protein YgfZ | - |
QU406_RS08590 (1768746) | 1768746..1769405 | - | 660 | WP_000250275.1 | hemolysin III family protein | - |
QU406_RS08595 (1769569) | 1769569..1769880 | - | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QU406_RS08600 (1769925) | 1769925..1771358 | + | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T297200 WP_000244765.1 NZ_OY019088:c1767199-1766792 [Escherichia coli O25b:H4-ST131]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |