Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 820364..821195 Replicon chromosome
Accession NZ_OY019088
Organism Escherichia coli O25b:H4-ST131 isolate 42

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QU406_RS04280 Protein ID WP_000854815.1
Coordinates 820821..821195 (+) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QU406_RS04275 Protein ID WP_001280918.1
Coordinates 820364..820732 (+) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QU406_RS04230 (815453) 815453..816199 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QU406_RS04235 (816282) 816282..816632 + 351 Protein_835 hypothetical protein -
QU406_RS04240 (816648) 816648..817058 + 411 WP_000846703.1 hypothetical protein -
QU406_RS04245 (817279) 817279..818097 + 819 WP_001542275.1 DUF932 domain-containing protein -
QU406_RS04250 (818097) 818097..818342 + 246 WP_001164966.1 hypothetical protein -
QU406_RS04255 (818436) 818436..818909 + 474 WP_001542276.1 antirestriction protein -
QU406_RS04260 (818925) 818925..819401 + 477 WP_001186200.1 RadC family protein -
QU406_RS04265 (819464) 819464..819685 + 222 WP_000692345.1 DUF987 domain-containing protein -
QU406_RS04270 (819704) 819704..820348 + 645 WP_000086752.1 hypothetical protein -
QU406_RS04275 (820364) 820364..820732 + 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QU406_RS04280 (820821) 820821..821195 + 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QU406_RS04285 (821192) 821192..821386 + 195 WP_000988600.1 DUF5983 family protein -
QU406_RS04290 (821432) 821432..821512 + 81 Protein_846 hypothetical protein -
QU406_RS04295 (821801) 821801..821881 - 81 WP_023441679.1 hypothetical protein -
QU406_RS04300 (821860) 821860..822183 + 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QU406_RS04305 (822284) 822284..822613 - 330 WP_000450409.1 DUF496 family protein -
QU406_RS04310 (822785) 822785..823843 - 1059 WP_001200889.1 FUSC family protein -
QU406_RS04315 (824041) 824041..824514 - 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QU406_RS04320 (824633) 824633..825799 - 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T297198 WP_000854815.1 NZ_OY019088:820821-821195 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT297198 WP_001280918.1 NZ_OY019088:820364-820732 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References