Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 25359..26029 Replicon plasmid p4782-IMP
Accession NZ_OX638703
Organism Pseudomonas aeruginosa strain 4782MK isolate 4782MK

Toxin (Protein)


Gene name vagD Uniprot ID Q2QCR9
Locus tag QSK41_RS35240 Protein ID WP_012477632.1
Coordinates 25359..25796 (-) Length 146 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q2QCS0
Locus tag QSK41_RS35245 Protein ID WP_012477631.1
Coordinates 25793..26029 (-) Length 79 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSK41_RS35200 (PAER4782_34935) 20693..20953 - 261 WP_285798250.1 hypothetical protein -
QSK41_RS35205 (PAER4782_34940) 21611..21823 - 213 WP_153334493.1 hypothetical protein -
QSK41_RS35210 (PAER4782_34945) 21871..22221 - 351 WP_285798251.1 TrfB-related DNA-binding protein -
QSK41_RS35215 (PAER4782_34950) 22282..22785 - 504 WP_015272402.1 hypothetical protein -
QSK41_RS35220 (PAER4782_34955) 22802..23230 - 429 WP_015272401.1 hypothetical protein -
QSK41_RS35225 (PAER4782_34960) 23286..24122 - 837 WP_015272400.1 DUF932 domain-containing protein -
QSK41_RS35230 (PAER4782_34965) 24803..25042 - 240 WP_220467819.1 hypothetical protein -
QSK41_RS35235 (PAER4782_34975) 25191..25352 - 162 WP_015272398.1 hypothetical protein -
QSK41_RS35240 (PAER4782_34980) 25359..25796 - 438 WP_012477632.1 type II toxin-antitoxin system VapC family toxin Toxin
QSK41_RS35245 (PAER4782_34985) 25793..26029 - 237 WP_012477631.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
QSK41_RS35250 (PAER4782_34990) 26039..26464 - 426 WP_015272397.1 DUF192 domain-containing protein -
QSK41_RS35255 (PAER4782_34995) 26938..27774 - 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -
QSK41_RS35260 (PAER4782_35000) 27774..28577 - 804 WP_001082319.1 aminoglycoside O-phosphotransferase APH(3'')-Ib -
QSK41_RS35265 28762..28992 + 231 WP_233694999.1 hypothetical protein -
QSK41_RS35270 (PAER4782_35005) 29006..29785 - 780 WP_058199817.1 APH(3')-VI family aminoglycoside O-phosphotransferase -
QSK41_RS35275 (PAER4782_35010) 30190..31026 - 837 WP_000480968.1 aminoglycoside O-phosphotransferase APH(6)-Id -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aph(6)-Id / aph(3'')-Ib / aph(3')-VIa / sul2 / blaIMP-23 / qnrVC4 / cmlA1 / blaOXA-10 katB 1..61494 61494


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-130)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 146 a.a.        Molecular weight: 15671.07 Da        Isoelectric Point: 8.5199

>T297192 WP_012477632.1 NZ_OX638703:c25796-25359 [Pseudomonas aeruginosa]
MSKKTYMLDTNICSFIMRERPDAVLAKLEQAVTNQHRIVVSAITYSEMRFGAANPKASPKVAAMVDAFIQRLDAILSWDA
AAVDQTTQIRTALARLGTPIGNNDAAIAGHALAAGCVLVTNNTREFARVPGLVLEDWTQPAITKS

Download         Length: 438 bp

Antitoxin


Download         Length: 79 a.a.        Molecular weight: 9070.29 Da        Isoelectric Point: 4.4563

>AT297192 WP_012477631.1 NZ_OX638703:c26029-25793 [Pseudomonas aeruginosa]
MRTVSIFMNSRNQAIRIPRDMEYQGVSELEIIRDGETLILRPVRPSWASLRDVAAADPDFLTERKDVIEEDRFLGDFT

Download         Length: 237 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A010RDD2

Antitoxin

Source ID Structure
AlphaFold DB A0A010SZE6

References