Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 6943545..6944159 | Replicon | chromosome |
| Accession | NZ_OX638701 | ||
| Organism | Pseudomonas aeruginosa strain 4782MK isolate 4782MK | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | QSK41_RS32605 | Protein ID | WP_071534354.1 |
| Coordinates | 6943977..6944159 (-) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | QSK41_RS32600 | Protein ID | WP_012077229.1 |
| Coordinates | 6943545..6943949 (-) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QSK41_RS32575 (PAER4782_32530) | 6939685..6940395 | + | 711 | WP_012074129.1 | hypothetical protein | - |
| QSK41_RS32580 (PAER4782_32535) | 6940392..6941312 | + | 921 | WP_012074128.1 | hypothetical protein | - |
| QSK41_RS32585 (PAER4782_32540) | 6941309..6941848 | + | 540 | WP_012074127.1 | hypothetical protein | - |
| QSK41_RS32590 (PAER4782_32545) | 6941848..6942546 | + | 699 | WP_033896049.1 | hypothetical protein | - |
| QSK41_RS32595 (PAER4782_32550) | 6942531..6943502 | + | 972 | WP_012077228.1 | hypothetical protein | - |
| QSK41_RS32600 (PAER4782_32555) | 6943545..6943949 | - | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| QSK41_RS32605 (PAER4782_32560) | 6943977..6944159 | - | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| QSK41_RS32610 (PAER4782_32565) | 6944702..6945634 | - | 933 | WP_003120918.1 | ZIP family metal transporter | - |
| QSK41_RS32615 (PAER4782_32570) | 6945653..6946264 | - | 612 | WP_003098862.1 | superoxide dismutase | - |
| QSK41_RS32620 (PAER4782_32575) | 6946277..6946726 | - | 450 | WP_003094369.1 | hypothetical protein | - |
| QSK41_RS32625 (PAER4782_32580) | 6946754..6948130 | - | 1377 | WP_003098863.1 | class II fumarate hydratase FumC | - |
| QSK41_RS32630 (PAER4782_32585) | 6948123..6948518 | - | 396 | WP_003162782.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 6906665..6944159 | 37494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T297191 WP_071534354.1 NZ_OX638701:c6944159-6943977 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT297191 WP_012077229.1 NZ_OX638701:c6943949-6943545 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |