Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 6943545..6944159 Replicon chromosome
Accession NZ_OX638701
Organism Pseudomonas aeruginosa strain 4782MK isolate 4782MK

Toxin (Protein)


Gene name hicA Uniprot ID A6VBH9
Locus tag QSK41_RS32605 Protein ID WP_071534354.1
Coordinates 6943977..6944159 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A140SDX7
Locus tag QSK41_RS32600 Protein ID WP_012077229.1
Coordinates 6943545..6943949 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QSK41_RS32575 (PAER4782_32530) 6939685..6940395 + 711 WP_012074129.1 hypothetical protein -
QSK41_RS32580 (PAER4782_32535) 6940392..6941312 + 921 WP_012074128.1 hypothetical protein -
QSK41_RS32585 (PAER4782_32540) 6941309..6941848 + 540 WP_012074127.1 hypothetical protein -
QSK41_RS32590 (PAER4782_32545) 6941848..6942546 + 699 WP_033896049.1 hypothetical protein -
QSK41_RS32595 (PAER4782_32550) 6942531..6943502 + 972 WP_012077228.1 hypothetical protein -
QSK41_RS32600 (PAER4782_32555) 6943545..6943949 - 405 WP_012077229.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QSK41_RS32605 (PAER4782_32560) 6943977..6944159 - 183 WP_071534354.1 type II toxin-antitoxin system HicA family toxin Toxin
QSK41_RS32610 (PAER4782_32565) 6944702..6945634 - 933 WP_003120918.1 ZIP family metal transporter -
QSK41_RS32615 (PAER4782_32570) 6945653..6946264 - 612 WP_003098862.1 superoxide dismutase -
QSK41_RS32620 (PAER4782_32575) 6946277..6946726 - 450 WP_003094369.1 hypothetical protein -
QSK41_RS32625 (PAER4782_32580) 6946754..6948130 - 1377 WP_003098863.1 class II fumarate hydratase FumC -
QSK41_RS32630 (PAER4782_32585) 6948123..6948518 - 396 WP_003162782.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 6906665..6944159 37494


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(3-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-127)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6702.74 Da        Isoelectric Point: 10.4826

>T297191 WP_071534354.1 NZ_OX638701:c6944159-6943977 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14670.54 Da        Isoelectric Point: 4.4315

>AT297191 WP_012077229.1 NZ_OX638701:c6943949-6943545 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A6VBH9

Antitoxin

Source ID Structure
AlphaFold DB A0A140SDX7

References