Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4227639..4228681 | Replicon | chromosome |
Accession | NZ_OX638701 | ||
Organism | Pseudomonas aeruginosa strain 4782MK isolate 4782MK |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | QSK41_RS19960 | Protein ID | WP_003153636.1 |
Coordinates | 4228106..4228681 (+) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | QSK41_RS19955 | Protein ID | WP_003050245.1 |
Coordinates | 4227639..4228109 (+) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSK41_RS19920 (PAER4782_19925) | 4223031..4224449 | - | 1419 | WP_006226029.1 | TIGR03752 family integrating conjugative element protein | - |
QSK41_RS19925 (PAER4782_19930) | 4224439..4225350 | - | 912 | WP_006226028.1 | TIGR03749 family integrating conjugative element protein | - |
QSK41_RS19930 (PAER4782_19935) | 4225347..4226039 | - | 693 | WP_003090182.1 | TIGR03746 family integrating conjugative element protein | - |
QSK41_RS19935 (PAER4782_19940) | 4226036..4226434 | - | 399 | WP_003050133.1 | TIGR03750 family conjugal transfer protein | - |
QSK41_RS19940 (PAER4782_19945) | 4226446..4226805 | - | 360 | WP_003090173.1 | TIGR03745 family integrating conjugative element membrane protein | - |
QSK41_RS19945 (PAER4782_19950) | 4226822..4227055 | - | 234 | WP_003090170.1 | TIGR03758 family integrating conjugative element protein | - |
QSK41_RS19950 (PAER4782_19955) | 4227052..4227435 | - | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
QSK41_RS19955 (PAER4782_19960) | 4227639..4228109 | + | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
QSK41_RS19960 (PAER4782_19965) | 4228106..4228681 | + | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
QSK41_RS19965 (PAER4782_19970) | 4228678..4229613 | + | 936 | WP_033970552.1 | AAA family ATPase | - |
QSK41_RS19970 (PAER4782_19975) | 4229610..4230080 | + | 471 | WP_003090160.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
QSK41_RS19975 (PAER4782_19980) | 4230077..4230577 | + | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
QSK41_RS19980 (PAER4782_19985) | 4230577..4231479 | + | 903 | WP_003090158.1 | CBASS oligonucleotide cyclase | - |
QSK41_RS19985 (PAER4782_19990) | 4231518..4232243 | + | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 4152831..4274797 | 121966 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T297188 WP_003153636.1 NZ_OX638701:4228106-4228681 [Pseudomonas aeruginosa]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT297188 WP_003050245.1 NZ_OX638701:4227639-4228109 [Pseudomonas aeruginosa]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|