Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 1428557..1429062 | Replicon | chromosome |
Accession | NZ_OX638701 | ||
Organism | Pseudomonas aeruginosa strain 4782MK isolate 4782MK |
Toxin (Protein)
Gene name | parE | Uniprot ID | V6A7K8 |
Locus tag | QSK41_RS06580 | Protein ID | WP_003083773.1 |
Coordinates | 1428557..1428838 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1C7BDS9 |
Locus tag | QSK41_RS06585 | Protein ID | WP_003083775.1 |
Coordinates | 1428835..1429062 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QSK41_RS06555 (PAER4782_06535) | 1423808..1425157 | + | 1350 | WP_003142411.1 | C4-dicarboxylate transporter DctA | - |
QSK41_RS06560 (PAER4782_06540) | 1425206..1425892 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QSK41_RS06565 (PAER4782_06545) | 1425993..1426727 | + | 735 | WP_003117208.1 | GntR family transcriptional regulator | - |
QSK41_RS06570 (PAER4782_06550) | 1426907..1427317 | + | 411 | WP_003110659.1 | aegerolysin family protein | - |
QSK41_RS06575 (PAER4782_06555) | 1427349..1428257 | - | 909 | WP_003083769.1 | LysR family transcriptional regulator | - |
QSK41_RS06580 (PAER4782_06560) | 1428557..1428838 | - | 282 | WP_003083773.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QSK41_RS06585 (PAER4782_06565) | 1428835..1429062 | - | 228 | WP_003083775.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QSK41_RS06590 (PAER4782_06570) | 1429237..1429857 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QSK41_RS06595 (PAER4782_06575) | 1429958..1430458 | + | 501 | WP_003162763.1 | LEA type 2 family protein | - |
QSK41_RS06600 (PAER4782_06580) | 1430531..1430872 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QSK41_RS06605 (PAER4782_06585) | 1430954..1432381 | - | 1428 | WP_003083784.1 | GABA permease | - |
QSK41_RS06610 (PAER4782_06590) | 1432550..1434043 | - | 1494 | WP_003101230.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10462.19 Da Isoelectric Point: 10.0435
>T297185 WP_003083773.1 NZ_OX638701:c1428838-1428557 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|