Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PemK-MazE
Location 32799..33334 Replicon plasmid p3541_2
Accession NZ_OX638612
Organism Pseudomonas aeruginosa strain 3541 isolate 3541

Toxin (Protein)


Gene name mazF Uniprot ID A0A7W6J9K5
Locus tag QPK16_RS33065 Protein ID WP_021561444.1
Coordinates 33014..33334 (+) Length 107 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID A0A7W6J9M0
Locus tag QPK16_RS33060 Protein ID WP_021561443.1
Coordinates 32799..33014 (+) Length 72 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QPK16_RS33040 (JCHGIK_01220) 27931..28941 + 1011 WP_094988306.1 alcohol dehydrogenase AdhP -
QPK16_RS33045 (JCHGIK_01225) 29452..30414 + 963 WP_004577240.1 IS30-like element ISPpu17 family transposase -
QPK16_RS33050 30673..31056 - 384 WP_285741067.1 aminoglycoside 6'-N-acetyltransferase AAC(6')-29 -
QPK16_RS33055 (JCHGIK_01240) 31325..32338 + 1014 WP_000845054.1 class 1 integron integrase IntI1 -
QPK16_RS33060 (JCHGIK_01245) 32799..33014 + 216 WP_021561443.1 antitoxin MazE family protein Antitoxin
QPK16_RS33065 (JCHGIK_01250) 33014..33334 + 321 WP_021561444.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
QPK16_RS33070 (JCHGIK_01255) 33570..34133 + 564 WP_021561445.1 recombinase family protein -
QPK16_RS33075 (JCHGIK_01260) 34130..34513 + 384 WP_021561446.1 hypothetical protein -
QPK16_RS33080 (JCHGIK_01265) 34685..35026 + 342 WP_123118602.1 hypothetical protein -
QPK16_RS33085 (JCHGIK_01270) 35041..35658 + 618 WP_123118601.1 recombinase family protein -
QPK16_RS33090 (JCHGIK_01275) 35645..36781 + 1137 WP_123118600.1 replication initiator protein A -
QPK16_RS33095 (JCHGIK_01280) 37393..38043 + 651 WP_015272395.1 DNA-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aac(6')-29b - 1..41313 41313
- inside IScluster/Tn aac(6')-29b - 29452..34133 4681


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(1-104)

Antitoxin

Antitoxin MazE-like

(7-70)


Sequences

Toxin        


Download         Length: 107 a.a.        Molecular weight: 11585.51 Da        Isoelectric Point: 6.2890

>T297183 WP_021561444.1 NZ_OX638612:33014-33334 [Pseudomonas aeruginosa]
MQRGDLVTVSLQGDYGKPRPALIVQSDLLTDLESVVLCPVTSDLRNAAFRVTVEPNPANGLRALSQVMVDKLSTLPRTKI
SEPFGRLDDERMKAIDRALLLVVGVI

Download         Length: 321 bp

Antitoxin


Download         Length: 72 a.a.        Molecular weight: 8159.19 Da        Isoelectric Point: 7.2801

>AT297183 WP_021561443.1 NZ_OX638612:32799-33014 [Pseudomonas aeruginosa]
MPSIHESKVARHRERMRAAGLRPVQFWVPDTRSPEFTAQVRKQCQSLKGDPAEAEVLRFTEEAASHVEGWE

Download         Length: 216 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7W6J9K5

Antitoxin

Source ID Structure
AlphaFold DB A0A7W6J9M0

References