Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
Location | 2274278..2274886 | Replicon | chromosome |
Accession | NZ_OX638610 | ||
Organism | Pseudomonas aeruginosa strain 3541 isolate 3541 |
Toxin (Protein)
Gene name | PfiT | Uniprot ID | Q9I5J9 |
Locus tag | QPK16_RS10465 | Protein ID | WP_003114156.1 |
Coordinates | 2274539..2274886 (+) | Length | 116 a.a. |
Antitoxin (Protein)
Gene name | PfiA | Uniprot ID | A0A0B0C355 |
Locus tag | QPK16_RS10460 | Protein ID | WP_003114155.1 |
Coordinates | 2274278..2274529 (+) | Length | 84 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPK16_RS10440 (JCHGIK_11800) | 2269925..2270281 | + | 357 | WP_003114150.1 | DUF2523 family protein | - |
QPK16_RS10445 (JCHGIK_11805) | 2270285..2271559 | + | 1275 | WP_043096062.1 | zonular occludens toxin family protein | - |
QPK16_RS10450 (JCHGIK_11815) | 2271789..2273081 | + | 1293 | WP_003115206.1 | hypothetical protein | - |
QPK16_RS10455 (JCHGIK_11820) | 2273081..2274064 | + | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
QPK16_RS10460 | 2274278..2274529 | + | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QPK16_RS10465 (JCHGIK_11825) | 2274539..2274886 | + | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QPK16_RS10470 | 2275174..2275815 | - | 642 | WP_003158902.1 | substrate-binding domain-containing protein | - |
QPK16_RS10475 | 2275937..2276242 | + | 306 | WP_003158903.1 | helix-turn-helix transcriptional regulator | - |
QPK16_RS10480 (JCHGIK_11830) | 2276341..2278689 | - | 2349 | WP_176031468.1 | S8 family peptidase | - |
QPK16_RS10485 (JCHGIK_11835) | 2278829..2279860 | - | 1032 | WP_003158906.1 | AAA family ATPase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | sul1 / blaIMP-13 | - | 2261229..2363644 | 102415 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T297178 WP_003114156.1 NZ_OX638610:2274539-2274886 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I5J9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0B0C355 |