Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 554592..555097 | Replicon | chromosome |
Accession | NZ_OX638610 | ||
Organism | Pseudomonas aeruginosa strain 3541 isolate 3541 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | QPK16_RS02640 | Protein ID | WP_003121619.1 |
Coordinates | 554816..555097 (+) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | QPK16_RS02635 | Protein ID | WP_003112628.1 |
Coordinates | 554592..554819 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QPK16_RS02610 (JCHGIK_03965) | 549610..551103 | + | 1494 | WP_043095997.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
QPK16_RS02615 (JCHGIK_03970) | 551272..552699 | + | 1428 | WP_003083784.1 | GABA permease | - |
QPK16_RS02620 (JCHGIK_03975) | 552781..553122 | - | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QPK16_RS02625 (JCHGIK_03980) | 553195..553695 | - | 501 | WP_003101228.1 | LEA type 2 family protein | - |
QPK16_RS02630 (JCHGIK_03985) | 553796..554416 | + | 621 | WP_003101226.1 | hypothetical protein | - |
QPK16_RS02635 (JCHGIK_03990) | 554592..554819 | + | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QPK16_RS02640 (JCHGIK_03995) | 554816..555097 | + | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QPK16_RS02645 (JCHGIK_04000) | 555397..556305 | + | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
QPK16_RS02650 (JCHGIK_04005) | 556337..556747 | - | 411 | WP_003101225.1 | aegerolysin family protein | - |
QPK16_RS02655 (JCHGIK_04010) | 556927..557661 | - | 735 | WP_043095998.1 | GntR family transcriptional regulator | - |
QPK16_RS02660 (JCHGIK_04015) | 557762..558448 | - | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QPK16_RS02665 (JCHGIK_04020) | 558497..559846 | - | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T297176 WP_003121619.1 NZ_OX638610:554816-555097 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 6XRW | |
AlphaFold DB | Q9I707 |