Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PfiT-PfiA/ParE(toxin) |
| Location | 5436037..5436645 | Replicon | chromosome |
| Accession | NZ_OX638564 | ||
| Organism | Pseudomonas aeruginosa strain 3796A isolate 3796A | ||
Toxin (Protein)
| Gene name | PfiT | Uniprot ID | Q9I5J9 |
| Locus tag | QRQ54_RS25405 | Protein ID | WP_003114156.1 |
| Coordinates | 5436037..5436384 (-) | Length | 116 a.a. |
Antitoxin (Protein)
| Gene name | PfiA | Uniprot ID | A0A0B0C355 |
| Locus tag | QRQ54_RS25410 | Protein ID | WP_003114155.1 |
| Coordinates | 5436394..5436645 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QRQ54_RS25385 (PAE3796A_25225) | 5431063..5432094 | + | 1032 | WP_003158906.1 | AAA family ATPase | - |
| QRQ54_RS25390 (PAE3796A_25230) | 5432234..5434582 | + | 2349 | WP_176031468.1 | S8 family peptidase | - |
| QRQ54_RS25395 | 5434681..5434986 | - | 306 | WP_003158903.1 | helix-turn-helix transcriptional regulator | - |
| QRQ54_RS25400 | 5435108..5435749 | + | 642 | WP_003158902.1 | substrate-binding domain-containing protein | - |
| QRQ54_RS25405 (PAE3796A_25235) | 5436037..5436384 | - | 348 | WP_003114156.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QRQ54_RS25410 | 5436394..5436645 | - | 252 | WP_003114155.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| QRQ54_RS25415 (PAE3796A_25240) | 5436859..5437842 | - | 984 | WP_003114154.1 | tyrosine-type recombinase/integrase | - |
| QRQ54_RS25420 (PAE3796A_25245) | 5437842..5439134 | - | 1293 | WP_003115206.1 | hypothetical protein | - |
| QRQ54_RS25425 (PAE3796A_25255) | 5439364..5440638 | - | 1275 | WP_043096062.1 | zonular occludens toxin family protein | - |
| QRQ54_RS25430 (PAE3796A_25260) | 5440642..5440998 | - | 357 | WP_003114150.1 | DUF2523 family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | blaIMP-13 / sul1 | - | 5290779..5449694 | 158915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 116 a.a. Molecular weight: 12984.78 Da Isoelectric Point: 4.4212
>T297173 WP_003114156.1 NZ_OX638564:c5436384-5436037 [Pseudomonas aeruginosa]
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
MSPVVIRFTDTAEQSIEDQVHHLAPFQGEQAALQSVLSLLDEIEEKISLAPKGYPVSQQASLLGVLSYRELNTGPYRVFY
EFHEEQGEVAVILVLRQKQSVEQQLIRYCLVGPIE
Download Length: 348 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | Q9I5J9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0B0C355 |