Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 154281..154786 | Replicon | chromosome |
Accession | NZ_OX638564 | ||
Organism | Pseudomonas aeruginosa strain 3796A isolate 3796A |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A069QL22 |
Locus tag | QRQ54_RS00705 | Protein ID | WP_003121619.1 |
Coordinates | 154281..154562 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | Q9I707 |
Locus tag | QRQ54_RS00710 | Protein ID | WP_003112628.1 |
Coordinates | 154559..154786 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QRQ54_RS00680 (PAE3796A_00640) | 149532..150881 | + | 1350 | WP_003119513.1 | C4-dicarboxylate transporter DctA | - |
QRQ54_RS00685 (PAE3796A_00645) | 150930..151616 | + | 687 | WP_003083762.1 | FadR/GntR family transcriptional regulator | - |
QRQ54_RS00690 (PAE3796A_00650) | 151717..152451 | + | 735 | WP_043095998.1 | GntR family transcriptional regulator | - |
QRQ54_RS00695 (PAE3796A_00655) | 152631..153041 | + | 411 | WP_003101225.1 | aegerolysin family protein | - |
QRQ54_RS00700 (PAE3796A_00660) | 153073..153981 | - | 909 | WP_016561475.1 | LysR family transcriptional regulator | - |
QRQ54_RS00705 (PAE3796A_00665) | 154281..154562 | - | 282 | WP_003121619.1 | type II toxin-antitoxin system toxin ParE | Toxin |
QRQ54_RS00710 (PAE3796A_00670) | 154559..154786 | - | 228 | WP_003112628.1 | CopG family ribbon-helix-helix protein | Antitoxin |
QRQ54_RS00715 (PAE3796A_00675) | 154962..155582 | - | 621 | WP_003101226.1 | hypothetical protein | - |
QRQ54_RS00720 (PAE3796A_00680) | 155683..156183 | + | 501 | WP_003101228.1 | LEA type 2 family protein | - |
QRQ54_RS00725 (PAE3796A_00685) | 156256..156597 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
QRQ54_RS00730 (PAE3796A_00690) | 156679..158106 | - | 1428 | WP_003083784.1 | GABA permease | - |
QRQ54_RS00735 (PAE3796A_00695) | 158275..159768 | - | 1494 | WP_043095997.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10492.22 Da Isoelectric Point: 10.0435
>T297169 WP_003121619.1 NZ_OX638564:c154562-154281 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDTIYDHYVVLIGPEKALKAVQDIVEQVKPLQQVANQGAGRPSEVPGVRTLTLERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A069QL22 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | Q9I707 |