Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
| Location | 114693..115218 | Replicon | plasmid P1 |
| Accession | NZ_OX637965 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 46 | ||
Toxin (Protein)
| Gene name | ccdB | Uniprot ID | V0SSI5 |
| Locus tag | QQG90_RS26360 | Protein ID | WP_001159868.1 |
| Coordinates | 114693..114998 (-) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | ccdA | Uniprot ID | S1PPD8 |
| Locus tag | QQG90_RS26365 | Protein ID | WP_000813634.1 |
| Coordinates | 115000..115218 (-) | Length | 73 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG90_RS26345 (110603) | 110603..111769 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
| QQG90_RS26350 (112357) | 112357..113112 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
| QQG90_RS26355 (113886) | 113886..114692 | - | 807 | WP_000016982.1 | site-specific integrase | - |
| QQG90_RS26360 (114693) | 114693..114998 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
| QQG90_RS26365 (115000) | 115000..115218 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
| QQG90_RS26370 (115798) | 115798..116886 | + | 1089 | WP_000952217.1 | transcriptional repressor PifC | - |
| QQG90_RS26375 (116888) | 116888..119113 | + | 2226 | WP_000698737.1 | P-loop NTPase fold protein | - |
| QQG90_RS26380 (119163) | 119163..120062 | - | 900 | WP_000963206.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | dfrA17 / aadA5 / qacE / sul1 | senB | 1..123938 | 123938 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T297165 WP_001159868.1 NZ_OX637965:c114998-114693 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|