Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4610424..4611225 Replicon chromosome
Accession NZ_OX637964
Organism Escherichia coli O25b:H4-ST131 isolate 46

Toxin (Protein)


Gene name yeeV Uniprot ID D8EBK0
Locus tag QQG90_RS23010 Protein ID WP_001094436.1
Coordinates 4610848..4611225 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID B7MN76
Locus tag QQG90_RS23005 Protein ID WP_015953067.1
Coordinates 4610424..4610801 (+) Length 126 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG90_RS22970 (4606336) 4606336..4607016 + 681 WP_001282927.1 WYL domain-containing protein -
QQG90_RS22975 (4607164) 4607164..4607841 + 678 WP_001097312.1 hypothetical protein -
QQG90_RS22980 (4607847) 4607847..4608080 + 234 WP_001278287.1 DUF905 family protein -
QQG90_RS22985 (4608170) 4608170..4608988 + 819 WP_001175142.1 DUF932 domain-containing protein -
QQG90_RS22990 (4609079) 4609079..4609564 + 486 WP_000860054.1 antirestriction protein -
QQG90_RS22995 (4609579) 4609579..4610055 + 477 WP_001186756.1 RadC family protein -
QQG90_RS23000 (4610124) 4610124..4610345 + 222 WP_000692312.1 DUF987 domain-containing protein -
QQG90_RS23005 (4610424) 4610424..4610801 + 378 WP_015953067.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQG90_RS23010 (4610848) 4610848..4611225 + 378 WP_001094436.1 TA system toxin CbtA family protein Toxin
QQG90_RS23015 (4611222) 4611222..4611710 + 489 WP_000761714.1 DUF5983 family protein -
QQG90_RS23020 (4611722) 4611722..4611919 + 198 WP_000839254.1 DUF957 domain-containing protein -
QQG90_RS23025 (4612004) 4612004..4612714 + 711 WP_001621817.1 DUF4942 domain-containing protein -
QQG90_RS23030 (4612763) 4612763..4613518 - 756 WP_000065240.1 IS21-like element ISEc10 family helper ATPase IstB -
QQG90_RS23035 (4613515) 4613515..4615014 - 1500 WP_029700729.1 IS21-like element ISEc10 family transposase -
QQG90_RS23040 (4615105) 4615105..4615266 + 162 Protein_4516 DUF4942 domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 13958.84 Da        Isoelectric Point: 6.8603

>T297158 WP_001094436.1 NZ_OX637964:4610848-4611225 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ

Download         Length: 378 bp

Antitoxin


Download         Length: 126 a.a.        Molecular weight: 13766.60 Da        Isoelectric Point: 6.2021

>AT297158 WP_015953067.1 NZ_OX637964:4610424-4610801 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV

Download         Length: 378 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E2L1N0

Antitoxin

Source ID Structure
AlphaFold DB A0A5Z3CIS0

References