Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4610424..4611225 | Replicon | chromosome |
Accession | NZ_OX637964 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 46 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | D8EBK0 |
Locus tag | QQG90_RS23010 | Protein ID | WP_001094436.1 |
Coordinates | 4610848..4611225 (+) | Length | 126 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | B7MN76 |
Locus tag | QQG90_RS23005 | Protein ID | WP_015953067.1 |
Coordinates | 4610424..4610801 (+) | Length | 126 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG90_RS22970 (4606336) | 4606336..4607016 | + | 681 | WP_001282927.1 | WYL domain-containing protein | - |
QQG90_RS22975 (4607164) | 4607164..4607841 | + | 678 | WP_001097312.1 | hypothetical protein | - |
QQG90_RS22980 (4607847) | 4607847..4608080 | + | 234 | WP_001278287.1 | DUF905 family protein | - |
QQG90_RS22985 (4608170) | 4608170..4608988 | + | 819 | WP_001175142.1 | DUF932 domain-containing protein | - |
QQG90_RS22990 (4609079) | 4609079..4609564 | + | 486 | WP_000860054.1 | antirestriction protein | - |
QQG90_RS22995 (4609579) | 4609579..4610055 | + | 477 | WP_001186756.1 | RadC family protein | - |
QQG90_RS23000 (4610124) | 4610124..4610345 | + | 222 | WP_000692312.1 | DUF987 domain-containing protein | - |
QQG90_RS23005 (4610424) | 4610424..4610801 | + | 378 | WP_015953067.1 | type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA | Antitoxin |
QQG90_RS23010 (4610848) | 4610848..4611225 | + | 378 | WP_001094436.1 | TA system toxin CbtA family protein | Toxin |
QQG90_RS23015 (4611222) | 4611222..4611710 | + | 489 | WP_000761714.1 | DUF5983 family protein | - |
QQG90_RS23020 (4611722) | 4611722..4611919 | + | 198 | WP_000839254.1 | DUF957 domain-containing protein | - |
QQG90_RS23025 (4612004) | 4612004..4612714 | + | 711 | WP_001621817.1 | DUF4942 domain-containing protein | - |
QQG90_RS23030 (4612763) | 4612763..4613518 | - | 756 | WP_000065240.1 | IS21-like element ISEc10 family helper ATPase IstB | - |
QQG90_RS23035 (4613515) | 4613515..4615014 | - | 1500 | WP_029700729.1 | IS21-like element ISEc10 family transposase | - |
QQG90_RS23040 (4615105) | 4615105..4615266 | + | 162 | Protein_4516 | DUF4942 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13958.84 Da Isoelectric Point: 6.8603
>T297158 WP_001094436.1 NZ_OX637964:4610848-4611225 [Escherichia coli O25b:H4-ST131]
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
MNTLPDTHVREASGCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKQ
Download Length: 378 bp
Antitoxin
Download Length: 126 a.a. Molecular weight: 13766.60 Da Isoelectric Point: 6.2021
>AT297158 WP_015953067.1 NZ_OX637964:4610424-4610801 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
VSDTLPGTTHPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTITLYAKGLTCEADTLGSCGYVYLAVYPTPAAPAITV
Download Length: 378 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0E2L1N0 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A5Z3CIS0 |