Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4338539..4339374 | Replicon | chromosome |
| Accession | NZ_OX637964 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 46 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A0J2AEA6 |
| Locus tag | QQG90_RS21590 | Protein ID | WP_000854759.1 |
| Coordinates | 4338539..4338916 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | S1NM52 |
| Locus tag | QQG90_RS21595 | Protein ID | WP_001295723.1 |
| Coordinates | 4339006..4339374 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG90_RS21565 (4334650) | 4334650..4336272 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QQG90_RS21570 (4336934) | 4336934..4337239 | - | 306 | Protein_4227 | helix-turn-helix domain-containing protein | - |
| QQG90_RS21575 (4337606) | 4337606..4337755 | - | 150 | Protein_4228 | hypothetical protein | - |
| QQG90_RS21580 (4337861) | 4337861..4338037 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QQG90_RS21585 (4338054) | 4338054..4338542 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QQG90_RS21590 (4338539) | 4338539..4338916 | - | 378 | WP_000854759.1 | TA system toxin CbtA family protein | Toxin |
| QQG90_RS21595 (4339006) | 4339006..4339374 | - | 369 | WP_001295723.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQG90_RS21600 (4339537) | 4339537..4339758 | - | 222 | WP_000692345.1 | DUF987 domain-containing protein | - |
| QQG90_RS21605 (4339821) | 4339821..4340297 | - | 477 | WP_001186726.1 | RadC family protein | - |
| QQG90_RS21610 (4340313) | 4340313..4340786 | - | 474 | WP_001350782.1 | antirestriction protein | - |
| QQG90_RS21615 (4341128) | 4341128..4341946 | - | 819 | WP_001234738.1 | DUF932 domain-containing protein | - |
| QQG90_RS21620 (4342064) | 4342064..4342259 | - | 196 | Protein_4237 | DUF905 family protein | - |
| QQG90_RS21625 (4342330) | 4342330..4344372 | - | 2043 | Protein_4238 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14144.26 Da Isoelectric Point: 7.3249
>T297156 WP_000854759.1 NZ_OX637964:c4338916-4338539 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVREVSCCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13592.40 Da Isoelectric Point: 6.6255
>AT297156 WP_001295723.1 NZ_OX637964:c4339374-4339006 [Escherichia coli O25b:H4-ST131]
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
VSDTLSGTTHPDDNDDHPWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGRFRDADAYPLDQAFPLLMKQLKLMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J2AEA6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | S1NM52 |