Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 4148021..4148541 Replicon chromosome
Accession NZ_OX637964
Organism Escherichia coli O25b:H4-ST131 isolate 46

Toxin (Protein)


Gene name ccdB Uniprot ID A0A061KX66
Locus tag QQG90_RS20670 Protein ID WP_001160964.1
Coordinates 4148021..4148305 (-) Length 95 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QQG90_RS20675 Protein ID WP_000125566.1
Coordinates 4148308..4148541 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG90_RS20645 (4143666) 4143666..4144952 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QQG90_RS20650 (4144952) 4144952..4145941 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QQG90_RS20655 (4145938) 4145938..4146759 + 822 WP_001065365.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QQG90_RS20660 (4146762) 4146762..4147139 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QQG90_RS20665 (4147146) 4147146..4147994 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QQG90_RS20670 (4148021) 4148021..4148305 - 285 WP_001160964.1 CcdB family protein Toxin
QQG90_RS20675 (4148308) 4148308..4148541 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QQG90_RS20680 (4148627) 4148627..4149106 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QQG90_RS20685 (4149298) 4149298..4151160 - 1863 WP_000377106.1 glutathione-regulated potassium-efflux system protein KefC -
QQG90_RS20690 (4151153) 4151153..4151683 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QQG90_RS20695 (4151791) 4151791..4153122 - 1332 WP_001183209.1 MFS transporter -
QQG90_RS20700 (4153181) 4153181..4153468 - 288 WP_000203744.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-93)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10692.54 Da        Isoelectric Point: 10.3030

>T297154 WP_001160964.1 NZ_OX637964:c4148305-4148021 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLIDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIK

Download         Length: 285 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT297154 WP_000125566.1 NZ_OX637964:c4148541-4148308 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A061KX66

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References