Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | Hha-TomB/- |
| Location | 3696334..3696952 | Replicon | chromosome |
| Accession | NZ_OX637964 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 46 | ||
Toxin (Protein)
| Gene name | Hha | Uniprot ID | H5UYE2 |
| Locus tag | QQG90_RS18515 | Protein ID | WP_001291435.1 |
| Coordinates | 3696734..3696952 (+) | Length | 73 a.a. |
Antitoxin (Protein)
| Gene name | TomB | Uniprot ID | S1PTH5 |
| Locus tag | QQG90_RS18510 | Protein ID | WP_000344800.1 |
| Coordinates | 3696334..3696708 (+) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG90_RS18500 (3691423) | 3691423..3692616 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
| QQG90_RS18505 (3692639) | 3692639..3695788 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
| QQG90_RS18510 (3696334) | 3696334..3696708 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
| QQG90_RS18515 (3696734) | 3696734..3696952 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
| QQG90_RS18520 (3697126) | 3697126..3697677 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
| QQG90_RS18525 (3697793) | 3697793..3698263 | + | 471 | WP_000136192.1 | YlaC family protein | - |
| QQG90_RS18530 (3698427) | 3698427..3699977 | + | 1551 | WP_001385227.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
| QQG90_RS18535 (3700019) | 3700019..3700372 | - | 354 | WP_000878135.1 | DUF1428 family protein | - |
| QQG90_RS18545 (3700751) | 3700751..3701062 | + | 312 | WP_000409908.1 | MGMT family protein | - |
| QQG90_RS18550 (3701093) | 3701093..3701665 | - | 573 | WP_000779831.1 | YbaY family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T297152 WP_001291435.1 NZ_OX637964:3696734-3696952 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT297152 WP_000344800.1 NZ_OX637964:3696334-3696708 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2MW2 | |
| PDB | 1JW2 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7U9QBQ5 |