Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1843930..1844761 Replicon chromosome
Accession NZ_OX637964
Organism Escherichia coli O25b:H4-ST131 isolate 46

Toxin (Protein)


Gene name yeeV Uniprot ID A0A066T988
Locus tag QQG90_RS08785 Protein ID WP_000854815.1
Coordinates 1843930..1844304 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A061Y7A8
Locus tag QQG90_RS08790 Protein ID WP_001280918.1
Coordinates 1844393..1844761 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG90_RS08745 (1839326) 1839326..1840492 + 1167 WP_001296209.1 serine-type D-Ala-D-Ala carboxypeptidase DacD -
QQG90_RS08750 (1840611) 1840611..1841084 + 474 WP_001105368.1 DNA gyrase inhibitor SbmC -
QQG90_RS08755 (1841282) 1841282..1842340 + 1059 WP_001200889.1 FUSC family protein -
QQG90_RS08760 (1842512) 1842512..1842841 + 330 WP_000450409.1 DUF496 family protein -
QQG90_RS08765 (1842942) 1842942..1843265 - 324 WP_225469267.1 EutP/PduV family microcompartment system protein -
QQG90_RS08770 (1843244) 1843244..1843324 + 81 WP_023441679.1 hypothetical protein -
QQG90_RS08775 (1843613) 1843613..1843693 - 81 Protein_1717 hypothetical protein -
QQG90_RS08780 (1843739) 1843739..1843933 - 195 WP_000988600.1 DUF5983 family protein -
QQG90_RS08785 (1843930) 1843930..1844304 - 375 WP_000854815.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQG90_RS08790 (1844393) 1844393..1844761 - 369 WP_001280918.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQG90_RS08795 (1844777) 1844777..1845421 - 645 WP_000086752.1 hypothetical protein -
QQG90_RS08800 (1845440) 1845440..1845661 - 222 WP_000692345.1 DUF987 domain-containing protein -
QQG90_RS08805 (1845724) 1845724..1846200 - 477 WP_001186200.1 RadC family protein -
QQG90_RS08810 (1846216) 1846216..1846689 - 474 WP_001542276.1 antirestriction protein -
QQG90_RS08815 (1846783) 1846783..1847028 - 246 WP_001164966.1 hypothetical protein -
QQG90_RS08820 (1847028) 1847028..1847846 - 819 WP_001542275.1 DUF932 domain-containing protein -
QQG90_RS08825 (1848067) 1848067..1848477 - 411 WP_000846703.1 hypothetical protein -
QQG90_RS08830 (1848493) 1848493..1848843 - 351 Protein_1728 hypothetical protein -
QQG90_RS08835 (1848926) 1848926..1849672 - 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(19-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13829.83 Da        Isoelectric Point: 7.1326

>T297145 WP_000854815.1 NZ_OX637964:c1844304-1843930 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTSDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13811.70 Da        Isoelectric Point: 6.4767

>AT297145 WP_001280918.1 NZ_OX637964:c1844761-1844393 [Escherichia coli O25b:H4-ST131]
VSDKLHETNYPDDHNDRLWWGLPCTVTPCFGARLVQEGNRLHYLADRAGIRGLFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A066T988

Antitoxin

Source ID Structure
AlphaFold DB A0A061Y7A8

References