Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 4169805..4170639 | Replicon | chromosome |
| Accession | NZ_OX637961 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 86 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A1J6XFW9 |
| Locus tag | QQG89_RS20370 | Protein ID | WP_000854770.1 |
| Coordinates | 4169805..4170182 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A1M1N885 |
| Locus tag | QQG89_RS20375 | Protein ID | WP_001280950.1 |
| Coordinates | 4170271..4170639 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG89_RS20345 (4165916) | 4165916..4167538 | - | 1623 | WP_001295726.1 | Alw26I/Eco31I/Esp3I family type II restriction adenine-specific DNA-methyltransferase | - |
| QQG89_RS20350 (4168200) | 4168200..4168505 | - | 306 | Protein_3989 | helix-turn-helix domain-containing protein | - |
| QQG89_RS20355 (4168872) | 4168872..4169021 | - | 150 | Protein_3990 | hypothetical protein | - |
| QQG89_RS20360 (4169127) | 4169127..4169303 | - | 177 | WP_000839286.1 | DUF957 domain-containing protein | - |
| QQG89_RS20365 (4169320) | 4169320..4169808 | - | 489 | WP_000761690.1 | DUF5983 family protein | - |
| QQG89_RS20370 (4169805) | 4169805..4170182 | - | 378 | WP_000854770.1 | TA system toxin CbtA family protein | Toxin |
| QQG89_RS20375 (4170271) | 4170271..4170639 | - | 369 | WP_001280950.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQG89_RS20380 (4170802) | 4170802..4171023 | - | 222 | WP_001220314.1 | DUF987 domain-containing protein | - |
| QQG89_RS20385 (4171086) | 4171086..4171562 | - | 477 | WP_001186779.1 | RadC family protein | - |
| QQG89_RS20390 (4171578) | 4171578..4172042 | - | 465 | WP_000855061.1 | antirestriction protein | - |
| QQG89_RS20395 (4172384) | 4172384..4173202 | - | 819 | WP_001234712.1 | DUF932 domain-containing protein | - |
| QQG89_RS20400 (4173320) | 4173320..4173515 | - | 196 | Protein_3999 | DUF905 family protein | - |
| QQG89_RS20405 (4173586) | 4173586..4175487 | - | 1902 | Protein_4000 | Ag43/Cah family autotransporter adhesin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4158159..4198368 | 40209 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14196.37 Da Isoelectric Point: 8.7438
>T297128 WP_000854770.1 NZ_OX637961:c4170182-4169805 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
MKTLPDTHVRKVSRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDLPGF
SACTHSQLINSIDILRARRATGLMIRDNYRTVNNITLGKHPEAKR
Download Length: 378 bp
Antitoxin
Download Length: 123 a.a. Molecular weight: 13737.56 Da Isoelectric Point: 7.0268
>AT297128 WP_001280950.1 NZ_OX637961:c4170639-4170271 [Escherichia coli O25b:H4-ST131]
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
VSDKLSGITHPDDNHDRPWWGLPCTVRPCFGARLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAFYPTSETKK
Download Length: 369 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1J6XFW9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A1M1N885 |