Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 4098949..4099525 | Replicon | chromosome |
| Accession | NZ_OX637961 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 86 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | D3GXZ2 |
| Locus tag | QQG89_RS20000 | Protein ID | WP_001297643.1 |
| Coordinates | 4099238..4099525 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A829G8Z0 |
| Locus tag | QQG89_RS19995 | Protein ID | WP_000063156.1 |
| Coordinates | 4098949..4099251 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG89_RS19980 (4095545) | 4095545..4097695 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
| QQG89_RS19985 (4097745) | 4097745..4097948 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
| QQG89_RS19990 (4097959) | 4097959..4098915 | + | 957 | WP_001297640.1 | GTPase | - |
| QQG89_RS19995 (4098949) | 4098949..4099251 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
| QQG89_RS20000 (4099238) | 4099238..4099525 | - | 288 | WP_001297643.1 | BrnT family toxin | Toxin |
| QQG89_RS20005 (4099724) | 4099724..4100421 | - | 698 | Protein_3920 | IS1 family transposase | - |
| QQG89_RS20010 (4100478) | 4100478..4100573 | + | 96 | Protein_3921 | dienelactone hydrolase family protein | - |
| QQG89_RS20015 (4100719) | 4100719..4101951 | + | 1233 | WP_001339512.1 | multidrug efflux MFS transporter MdtM | - |
| QQG89_RS20020 (4101992) | 4101992..4103272 | + | 1281 | WP_001037382.1 | DUF445 domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11295.77 Da Isoelectric Point: 6.8821
>T297127 WP_001297643.1 NZ_OX637961:c4099525-4099238 [Escherichia coli O25b:H4-ST131]
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829GEV9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A829G8Z0 |