Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2852663..2853134 | Replicon | chromosome |
Accession | NZ_OX637961 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 86 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | QQG89_RS14005 | Protein ID | WP_001303511.1 |
Coordinates | 2852856..2853134 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | QQG89_RS14000 | Protein ID | WP_001302048.1 |
Coordinates | 2852663..2852854 (+) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG89_RS13955 (2847912) | 2847912..2848130 | - | 219 | WP_001610644.1 | DUF4014 family protein | - |
QQG89_RS13960 (2848163) | 2848163..2848375 | - | 213 | WP_000072553.1 | hypothetical protein | - |
QQG89_RS13965 (2848481) | 2848481..2848903 | - | 423 | Protein_2742 | DUF977 family protein | - |
QQG89_RS13970 (2848919) | 2848919..2849689 | - | 771 | WP_000450998.1 | DUF1627 domain-containing protein | - |
QQG89_RS13975 (2849711) | 2849711..2850457 | - | 747 | WP_000788950.1 | ATP-binding protein | - |
QQG89_RS13980 (2850464) | 2850464..2851426 | - | 963 | WP_000095673.1 | helix-turn-helix domain-containing protein | - |
QQG89_RS13985 (2851449) | 2851449..2851874 | - | 426 | WP_000693943.1 | toxin YdaT family protein | - |
QQG89_RS13990 (2851871) | 2851871..2852173 | - | 303 | WP_001556930.1 | transcriptional regulator | - |
QQG89_RS13995 (2852271) | 2852271..2852642 | + | 372 | WP_001169687.1 | hypothetical protein | - |
QQG89_RS14000 (2852663) | 2852663..2852854 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
QQG89_RS14005 (2852856) | 2852856..2853134 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQG89_RS14010 (2853425) | 2853425..2853577 | + | 153 | WP_000380313.1 | DUF1391 family protein | - |
QQG89_RS14015 (2853589) | 2853589..2853927 | + | 339 | WP_000394541.1 | hypothetical protein | - |
QQG89_RS14020 (2853916) | 2853916..2854110 | - | 195 | WP_001295058.1 | hypothetical protein | - |
QQG89_RS14025 (2854686) | 2854686..2854874 | + | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
QQG89_RS14030 (2854871) | 2854871..2855059 | + | 189 | WP_000199475.1 | DUF1482 family protein | - |
QQG89_RS14035 (2855152) | 2855152..2857590 | + | 2439 | WP_000102132.1 | exonuclease | - |
QQG89_RS14040 (2857652) | 2857652..2857921 | + | 270 | WP_000003742.1 | excisionase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2835273..2862315 | 27042 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T297121 WP_001303511.1 NZ_OX637961:2852856-2853134 [Escherichia coli O25b:H4-ST131]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|