Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1915134..1915965 Replicon chromosome
Accession NZ_OX637961
Organism Escherichia coli O25b:H4-ST131 isolate 86

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQG89_RS09135 Protein ID WP_000854814.1
Coordinates 1915134..1915508 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QQG89_RS09140 Protein ID WP_001546021.1
Coordinates 1915597..1915965 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG89_RS09100 (1911129) 1911129..1911458 + 330 WP_000450409.1 DUF496 family protein -
QQG89_RS09105 (1911559) 1911559..1911882 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QQG89_RS09110 (1911861) 1911861..1911941 + 81 WP_023441679.1 hypothetical protein -
QQG89_RS09115 (1912152) 1912152..1913693 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QQG89_RS09120 (1913708) 1913708..1914454 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QQG89_RS09125 (1914817) 1914817..1914897 - 81 Protein_1787 hypothetical protein -
QQG89_RS09130 (1914943) 1914943..1915137 - 195 WP_000988601.1 DUF5983 family protein -
QQG89_RS09135 (1915134) 1915134..1915508 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQG89_RS09140 (1915597) 1915597..1915965 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQG89_RS09145 (1916045) 1916045..1916266 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQG89_RS09150 (1916329) 1916329..1916805 - 477 WP_001186773.1 RadC family protein -
QQG89_RS09155 (1916821) 1916821..1917294 - 474 WP_001385393.1 antirestriction protein -
QQG89_RS09160 (1917557) 1917557..1918378 - 822 WP_001234710.1 DUF932 domain-containing protein -
QQG89_RS09165 (1918599) 1918599..1919009 - 411 WP_000846704.1 hypothetical protein -
QQG89_RS09170 (1919025) 1919025..1919702 - 678 WP_001362823.1 hypothetical protein -
QQG89_RS09175 (1919838) 1919838..1920908 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T297115 WP_000854814.1 NZ_OX637961:c1915508-1915134 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT297115 WP_001546021.1 NZ_OX637961:c1915965-1915597 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References