Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 965160..965814 | Replicon | chromosome |
Accession | NZ_OX637961 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 86 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | F4T2L4 |
Locus tag | QQG89_RS04760 | Protein ID | WP_000244765.1 |
Coordinates | 965407..965814 (+) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | F4T2L5 |
Locus tag | QQG89_RS04755 | Protein ID | WP_000354050.1 |
Coordinates | 965160..965426 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG89_RS04735 (961248) | 961248..962681 | - | 1434 | WP_001296350.1 | 6-phospho-beta-glucosidase BglA | - |
QQG89_RS04740 (962726) | 962726..963037 | + | 312 | WP_001182956.1 | N(4)-acetylcytidine aminohydrolase | - |
QQG89_RS04745 (963201) | 963201..963860 | + | 660 | WP_000250275.1 | hemolysin III family protein | - |
QQG89_RS04750 (963937) | 963937..964917 | - | 981 | WP_000886080.1 | tRNA-modifying protein YgfZ | - |
QQG89_RS04755 (965160) | 965160..965426 | + | 267 | WP_000354050.1 | FAD assembly factor SdhE | Antitoxin |
QQG89_RS04760 (965407) | 965407..965814 | + | 408 | WP_000244765.1 | protein YgfX | Toxin |
QQG89_RS04765 (965854) | 965854..966375 | - | 522 | WP_001055874.1 | flavodoxin FldB | - |
QQG89_RS04770 (966487) | 966487..967383 | + | 897 | WP_000806638.1 | site-specific tyrosine recombinase XerD | - |
QQG89_RS04775 (967408) | 967408..968118 | + | 711 | WP_000715230.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
QQG89_RS04780 (968124) | 968124..969857 | + | 1734 | WP_000813195.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 16043.95 Da Isoelectric Point: 11.5202
>T297113 WP_000244765.1 NZ_OX637961:965407-965814 [Escherichia coli O25b:H4-ST131]
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
VVLWQSDLRVSWRAQWLSLLIHGLVAAVILLIPWPLSYTPLWMVLLSLVVFDCVRSQRRINARQGEIRLLMDGRLRWQGQ
EWSIVKAPWMIKSGMMLRLRSDSGKRQHLWLAADSMDEAEWRDLRRILLQQETQR
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A454A7D7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A061L3F4 |