297107

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-Phd
Location 153967..154568 Replicon plasmid P1
Accession NZ_OX637960
Organism Escherichia coli O25b:H4-ST131 isolate 32

Toxin (Protein)


Gene name doc Uniprot ID V0AJ64
Locus tag QQG88_RS24760 Protein ID WP_001216034.1
Coordinates 154188..154568 (+) Length 127 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID U9YQH9
Locus tag QQG88_RS24755 Protein ID WP_001190712.1
Coordinates 153967..154188 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG88_RS24745 (150948) 150948..152231 - 1284 WP_001617890.1 restriction endonuclease subunit S -
QQG88_RS24750 (152228) 152228..153784 - 1557 WP_001617892.1 type I restriction-modification system subunit M -
QQG88_RS24755 (153967) 153967..154188 + 222 WP_001190712.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
QQG88_RS24760 (154188) 154188..154568 + 381 WP_001216034.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
QQG88_RS24765 (154573) 154573..154752 + 180 WP_001513661.1 hypothetical protein -
QQG88_RS24770 (154780) 154780..155058 + 279 Protein_178 pdcB -
QQG88_RS24775 (155063) 155063..155476 + 414 Protein_179 integrase core domain-containing protein -
QQG88_RS24780 (155426) 155426..155761 - 336 WP_169329198.1 type I deoxyribonuclease HsdR -
QQG88_RS24785 (155971) 155971..156951 - 981 WP_000019407.1 IS5-like element IS5 family transposase -
QQG88_RS24790 (157195) 157195..158598 + 1404 WP_001373486.1 S-methylmethionine permease -
QQG88_RS24795 (158585) 158585..159517 + 933 WP_000081352.1 homocysteine S-methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid aadA5 / qacE / sul1 / mph(A) / blaCTX-M-27 / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr senB 1..162859 162859


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Death on curing protein

(2-123)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-51)


Sequences

Toxin        


Download         Length: 127 a.a.        Molecular weight: 13615.32 Da        Isoelectric Point: 5.1514

>T297107 WP_001216034.1 NZ_OX637960:154188-154568 [Escherichia coli O25b:H4-ST131]
MRHISPEELIALHDANINRYGGLPGMSDPGRAEAIIGRVQARVAYEEITDLFEVSATYLVATARGHIFNDANKRTALNSA
LLFLRRNGVQVFDSPELADLTVGAATGEISVSSVADTLRRLYGSAE

Download         Length: 381 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8133.10 Da        Isoelectric Point: 4.7708

>AT297107 WP_001190712.1 NZ_OX637960:153967-154188 [Escherichia coli O25b:H4-ST131]
MQSINFRTARGNLSEVLNNVEAGEEVEITRRGREPAVIVSKATFEAYKKAALDAEFASLFDTLDSTNKELVNR

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB V0AJ64

Antitoxin

Source ID Structure
AlphaFold DB A0A829CJB6

References