Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ccdAB/CcdA(antitoxin) |
Location | 143498..144023 | Replicon | plasmid P1 |
Accession | NZ_OX637960 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | ccdB | Uniprot ID | V0SSI5 |
Locus tag | QQG88_RS24715 | Protein ID | WP_001159868.1 |
Coordinates | 143498..143803 (-) | Length | 102 a.a. |
Antitoxin (Protein)
Gene name | ccdA | Uniprot ID | S1PPD8 |
Locus tag | QQG88_RS24720 | Protein ID | WP_000813634.1 |
Coordinates | 143805..144023 (-) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS24700 (139408) | 139408..140574 | - | 1167 | WP_000772446.1 | plasmid-partitioning protein SopA | - |
QQG88_RS24705 (141162) | 141162..141917 | - | 756 | WP_000852146.1 | replication initiation protein RepE | - |
QQG88_RS24710 (142691) | 142691..143497 | - | 807 | WP_000016982.1 | site-specific integrase | - |
QQG88_RS24715 (143498) | 143498..143803 | - | 306 | WP_001159868.1 | type II toxin-antitoxin system toxin CcdB | Toxin |
QQG88_RS24720 (143805) | 143805..144023 | - | 219 | WP_000813634.1 | type II toxin-antitoxin system antitoxin CcdA | Antitoxin |
QQG88_RS24725 (144731) | 144731..145726 | + | 996 | WP_000246636.1 | hypothetical protein | - |
QQG88_RS24730 (145730) | 145730..146662 | + | 933 | WP_000991832.1 | S-4TM family putative pore-forming effector | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | aadA5 / qacE / sul1 / mph(A) / blaCTX-M-27 / blaCTX-M-15 / aac(3)-IIa / blaOXA-1 / aac(6')-Ib-cr | senB | 1..162859 | 162859 | |
- | flank | IS/Tn | - | - | 146799..147176 | 377 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11706.51 Da Isoelectric Point: 6.4674
>T297106 WP_001159868.1 NZ_OX637960:c143803-143498 [Escherichia coli O25b:H4-ST131]
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
MQFKVYTYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESWRMMTTDMASVPVSVIGEEV
ADLSHRENDIKNAINLMFWGI
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|