Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
Location | 4102828..4103404 | Replicon | chromosome |
Accession | NZ_OX637959 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | shpA | Uniprot ID | D3GXZ2 |
Locus tag | QQG88_RS20025 | Protein ID | WP_001297643.1 |
Coordinates | 4103117..4103404 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | shpB | Uniprot ID | A0A829G8Z0 |
Locus tag | QQG88_RS20020 | Protein ID | WP_000063156.1 |
Coordinates | 4102828..4103130 (-) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS20005 (4099424) | 4099424..4101574 | + | 2151 | WP_001295524.1 | pyruvate/proton symporter BtsT | - |
QQG88_RS20010 (4101624) | 4101624..4101827 | + | 204 | WP_000467859.1 | YbdD/YjiX family protein | - |
QQG88_RS20015 (4101838) | 4101838..4102794 | + | 957 | WP_001297640.1 | GTPase | - |
QQG88_RS20020 (4102828) | 4102828..4103130 | - | 303 | WP_000063156.1 | BrnA antitoxin family protein | Antitoxin |
QQG88_RS20025 (4103117) | 4103117..4103404 | - | 288 | WP_001297643.1 | BrnT family toxin | Toxin |
QQG88_RS20030 (4103603) | 4103603..4104300 | - | 698 | Protein_3925 | IS1 family transposase | - |
QQG88_RS20035 (4104357) | 4104357..4104452 | + | 96 | Protein_3926 | dienelactone hydrolase family protein | - |
QQG88_RS20040 (4104598) | 4104598..4105830 | + | 1233 | WP_001339512.1 | multidrug efflux MFS transporter MdtM | - |
QQG88_RS20045 (4105871) | 4105871..4107151 | + | 1281 | WP_001037382.1 | DUF445 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11295.77 Da Isoelectric Point: 6.8821
>T297100 WP_001297643.1 NZ_OX637959:c4103404-4103117 [Escherichia coli O25b:H4-ST131]
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
MPMEFEWDENKAKSNRVKHGIRFEDAVLLFDDPQHLSQQERIENGEYRWQTIGLVYGIVVILVAHTIRFESGNEIIRIIS
ARKADRKERNRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829GEV9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829G8Z0 |