Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 3993117..3993667 Replicon chromosome
Accession NZ_OX637959
Organism Escherichia coli O25b:H4-ST131 isolate 32

Toxin (Protein)


Gene name ccdB Uniprot ID S1PDG4
Locus tag QQG88_RS19485 Protein ID WP_001160966.1
Coordinates 3993117..3993431 (-) Length 105 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID V0VEX8
Locus tag QQG88_RS19490 Protein ID WP_000125566.1
Coordinates 3993434..3993667 (-) Length 78 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG88_RS19460 (3988792) 3988792..3990078 + 1287 WP_000800457.1 peptidylprolyl isomerase SurA -
QQG88_RS19465 (3990078) 3990078..3991067 + 990 WP_000241227.1 4-hydroxythreonine-4-phosphate dehydrogenase PdxA -
QQG88_RS19470 (3991064) 3991064..3991885 + 822 WP_001065363.1 16S rRNA (adenine(1518)-N(6)/adenine(1519)-N(6))- dimethyltransferase RsmA -
QQG88_RS19475 (3991888) 3991888..3992265 + 378 WP_000610901.1 Co2+/Mg2+ efflux protein ApaG -
QQG88_RS19480 (3992272) 3992272..3993120 + 849 WP_000257181.1 bis(5'-nucleosyl)-tetraphosphatase (symmetrical) ApaH -
QQG88_RS19485 (3993117) 3993117..3993431 - 315 WP_001160966.1 CcdB family protein Toxin
QQG88_RS19490 (3993434) 3993434..3993667 - 234 WP_000125566.1 type II toxin-antitoxin system CcdA family antitoxin Antitoxin
QQG88_RS19495 (3993753) 3993753..3994232 - 480 WP_000624375.1 type 3 dihydrofolate reductase -
QQG88_RS19500 (3994424) 3994424..3996286 - 1863 WP_000377124.1 glutathione-regulated potassium-efflux system protein KefC -
QQG88_RS19505 (3996279) 3996279..3996809 - 531 WP_000600725.1 glutathione-regulated potassium-efflux system oxidoreductase KefF -
QQG88_RS19510 (3996917) 3996917..3998248 - 1332 WP_001183207.1 MFS transporter -
QQG88_RS19515 (3998307) 3998307..3998594 - 288 WP_000203741.1 ferredoxin-like protein FixX -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-103)

Antitoxin

Post-segregation antitoxin CcdA

(8-77)


Sequences

Toxin        


Download         Length: 105 a.a.        Molecular weight: 11711.72 Da        Isoelectric Point: 9.0851

>T297099 WP_001160966.1 NZ_OX637959:c3993431-3993117 [Escherichia coli O25b:H4-ST131]
MQFTVYRSRGRNAAFPFVIDVTSDIIGEINRRIVIPLTPIERFSRIRPPERLNPILLLVDGKEYVLMTHETATVPVNALG
TKFCDASAHRTLIKGALDFMLDGI

Download         Length: 315 bp

Antitoxin


Download         Length: 78 a.a.        Molecular weight: 8530.53 Da        Isoelectric Point: 5.8062

>AT297099 WP_000125566.1 NZ_OX637959:c3993667-3993434 [Escherichia coli O25b:H4-ST131]
MTAKRTTQSVTVTVDRELVNRARDAGLNMSATLTVALNAELKKHAATRWREENAEAIAALNQLADETGCFSDEYRSF

Download         Length: 234 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829G815

Antitoxin

Source ID Structure
AlphaFold DB A0A7U9LTM9

References