Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3600671..3601289 | Replicon | chromosome |
Accession | NZ_OX637959 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | H5UYE2 |
Locus tag | QQG88_RS17630 | Protein ID | WP_001291435.1 |
Coordinates | 3601071..3601289 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | S1PTH5 |
Locus tag | QQG88_RS17625 | Protein ID | WP_000344800.1 |
Coordinates | 3600671..3601045 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS17615 (3595760) | 3595760..3596953 | + | 1194 | WP_001295833.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
QQG88_RS17620 (3596976) | 3596976..3600125 | + | 3150 | WP_001132478.1 | efflux RND transporter permease AcrB | - |
QQG88_RS17625 (3600671) | 3600671..3601045 | + | 375 | WP_000344800.1 | Hha toxicity modulator TomB | Antitoxin |
QQG88_RS17630 (3601071) | 3601071..3601289 | + | 219 | WP_001291435.1 | HHA domain-containing protein | Toxin |
QQG88_RS17635 (3601462) | 3601462..3602013 | + | 552 | WP_000102539.1 | maltose O-acetyltransferase | - |
QQG88_RS17640 (3602129) | 3602129..3602599 | + | 471 | WP_000136192.1 | YlaC family protein | - |
QQG88_RS17645 (3602763) | 3602763..3604313 | + | 1551 | WP_001545832.1 | cyclic-guanylate-specific phosphodiesterase PdeB | - |
QQG88_RS17650 (3604355) | 3604355..3604708 | - | 354 | WP_000878147.1 | DUF1428 family protein | - |
QQG88_RS17660 (3605087) | 3605087..3605398 | + | 312 | WP_000409908.1 | MGMT family protein | - |
QQG88_RS17665 (3605429) | 3605429..3606001 | - | 573 | WP_000779841.1 | YbaY family lipoprotein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T297097 WP_001291435.1 NZ_OX637959:3601071-3601289 [Escherichia coli O25b:H4-ST131]
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
MSEKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPSSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14557.39 Da Isoelectric Point: 4.7395
>AT297097 WP_000344800.1 NZ_OX637959:3600671-3601045 [Escherichia coli O25b:H4-ST131]
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
MDEYSPKRHDIAQLKFLCETLYHDCLANLEESNHGWVNDPTSAINLQLNELIEHIATFALNYKIKYNEDNKLIEQIDEYL
DDTFMLFSSYGINMQDLQKWRKSGNRLFRCFVNATKENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 2MW2 | |
PDB | 1JW2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A7U9QBQ5 |