Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 3094331..3095129 | Replicon | chromosome |
| Accession | NZ_OX637959 | ||
| Organism | Escherichia coli O25b:H4-ST131 isolate 32 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | - |
| Locus tag | QQG88_RS15160 | Protein ID | WP_096846886.1 |
| Coordinates | 3094331..3094708 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | A0A0P7R0L9 |
| Locus tag | QQG88_RS15165 | Protein ID | WP_001285482.1 |
| Coordinates | 3094755..3095129 (-) | Length | 125 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QQG88_RS15130 (3091006) | 3091006..3091710 | + | 705 | WP_001241674.1 | leucyl/phenylalanyl-tRNA--protein transferase | - |
| QQG88_RS15135 (3091995) | 3091995..3092213 | + | 219 | WP_001040187.1 | translation initiation factor IF-1 | - |
| QQG88_RS15145 (3092704) | 3092704..3093540 | - | 837 | Protein_2975 | DUF4942 domain-containing protein | - |
| QQG88_RS15150 (3093637) | 3093637..3093834 | - | 198 | WP_000839287.1 | DUF957 domain-containing protein | - |
| QQG88_RS15155 (3093831) | 3093831..3094334 | - | 504 | WP_021531035.1 | DUF5983 family protein | - |
| QQG88_RS15160 (3094331) | 3094331..3094708 | - | 378 | WP_096846886.1 | TA system toxin CbtA family protein | Toxin |
| QQG88_RS15165 (3094755) | 3094755..3095129 | - | 375 | WP_001285482.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| QQG88_RS15170 (3095179) | 3095179..3095823 | - | 645 | WP_033545319.1 | hypothetical protein | - |
| QQG88_RS15175 (3095842) | 3095842..3096063 | - | 222 | WP_000692315.1 | DUF987 domain-containing protein | - |
| QQG88_RS15180 (3096126) | 3096126..3096602 | - | 477 | WP_001313574.1 | RadC family protein | - |
| QQG88_RS15185 (3096618) | 3096618..3097091 | - | 474 | WP_001313575.1 | antirestriction protein | - |
| QQG88_RS15190 (3097185) | 3097185..3097430 | - | 246 | WP_001164966.1 | hypothetical protein | - |
| QQG88_RS15195 (3097430) | 3097430..3098251 | - | 822 | WP_021567056.1 | DUF932 domain-containing protein | - |
| QQG88_RS15200 (3098430) | 3098430..3098519 | - | 90 | WP_112031555.1 | DUF905 family protein | - |
| QQG88_RS15205 (3098662) | 3098662..3099117 | - | 456 | WP_000581502.1 | IrmA family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 14045.01 Da Isoelectric Point: 7.9086
>T297095 WP_096846886.1 NZ_OX637959:c3094708-3094331 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVREASRSPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
MKTLPDTHVREASRSPSPVTIWQTLLTQLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMVRDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 13791.44 Da Isoelectric Point: 4.7511
>AT297095 WP_001285482.1 NZ_OX637959:c3095129-3094755 [Escherichia coli O25b:H4-ST131]
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
VSDTLHETNYPDDNNDRPWWGLPCTVTPCFGARLVQEGNQLHYLADRAGIRGQFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYARGLTCEADTLGSCGYVYMAVYPTLAPATTS
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|