Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | paaR-paaA-parE/- |
Location | 2852641..2853112 | Replicon | chromosome |
Accession | NZ_OX637959 | ||
Organism | Escherichia coli O25b:H4-ST131 isolate 32 |
Toxin (Protein)
Gene name | parE_1 | Uniprot ID | A0A0D7C2L1 |
Locus tag | QQG88_RS14005 | Protein ID | WP_001303511.1 |
Coordinates | 2852834..2853112 (+) | Length | 93 a.a. |
Antitoxin (Protein)
Gene name | paaA | Uniprot ID | Q8XAD5 |
Locus tag | QQG88_RS14000 | Protein ID | WP_001302048.1 |
Coordinates | 2852641..2852832 (+) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QQG88_RS13955 (2847890) | 2847890..2848108 | - | 219 | WP_001610644.1 | DUF4014 family protein | - |
QQG88_RS13960 (2848141) | 2848141..2848353 | - | 213 | WP_000072553.1 | hypothetical protein | - |
QQG88_RS13965 (2848459) | 2848459..2848881 | - | 423 | Protein_2742 | DUF977 family protein | - |
QQG88_RS13970 (2848897) | 2848897..2849667 | - | 771 | WP_000450998.1 | DUF1627 domain-containing protein | - |
QQG88_RS13975 (2849689) | 2849689..2850435 | - | 747 | WP_000788950.1 | ATP-binding protein | - |
QQG88_RS13980 (2850442) | 2850442..2851404 | - | 963 | WP_000095673.1 | helix-turn-helix domain-containing protein | - |
QQG88_RS13985 (2851427) | 2851427..2851852 | - | 426 | WP_000693943.1 | toxin YdaT family protein | - |
QQG88_RS13990 (2851849) | 2851849..2852151 | - | 303 | WP_001556930.1 | transcriptional regulator | - |
QQG88_RS13995 (2852249) | 2852249..2852620 | + | 372 | WP_001169687.1 | hypothetical protein | - |
QQG88_RS14000 (2852641) | 2852641..2852832 | + | 192 | WP_001302048.1 | hypothetical protein | Antitoxin |
QQG88_RS14005 (2852834) | 2852834..2853112 | + | 279 | WP_001303511.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QQG88_RS14010 (2853403) | 2853403..2853555 | + | 153 | WP_000380313.1 | DUF1391 family protein | - |
QQG88_RS14015 (2853567) | 2853567..2853905 | + | 339 | WP_000394541.1 | hypothetical protein | - |
QQG88_RS14020 (2853894) | 2853894..2854088 | - | 195 | WP_001295058.1 | hypothetical protein | - |
QQG88_RS14025 (2854664) | 2854664..2854852 | + | 189 | WP_000449175.1 | cell division inhibition protein DicB | - |
QQG88_RS14030 (2854849) | 2854849..2855037 | + | 189 | WP_000199475.1 | DUF1482 family protein | - |
QQG88_RS14035 (2855130) | 2855130..2857568 | + | 2439 | WP_000102132.1 | exonuclease | - |
QQG88_RS14040 (2857630) | 2857630..2857899 | + | 270 | WP_000003742.1 | excisionase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 2835248..2862293 | 27045 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 93 a.a. Molecular weight: 10661.25 Da Isoelectric Point: 5.5647
>T297094 WP_001303511.1 NZ_OX637959:2852834-2853112 [Escherichia coli O25b:H4-ST131]
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
MLPVLWLESADTDLDDITSYIARFDIDAAERLWQRLRGCVLPLSEHPYLYPPSDRVPGLREIVAHPNYIILYRVTTSSVE
VVNVIHARRQFP
Download Length: 279 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
PDB | 5CZF | |
PDB | 5CW7 | |
PDB | 5CZE |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A829CTP0 |