297088

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1915131..1915962 Replicon chromosome
Accession NZ_OX637959
Organism Escherichia coli O25b:H4-ST131 isolate 32

Toxin (Protein)


Gene name yeeV Uniprot ID S1P968
Locus tag QQG88_RS09135 Protein ID WP_000854814.1
Coordinates 1915131..1915505 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A641DSP2
Locus tag QQG88_RS09140 Protein ID WP_001546021.1
Coordinates 1915594..1915962 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG88_RS09100 (1911126) 1911126..1911455 + 330 WP_000450409.1 DUF496 family protein -
QQG88_RS09105 (1911556) 1911556..1911879 - 324 WP_223216378.1 EutP/PduV family microcompartment system protein -
QQG88_RS09110 (1911858) 1911858..1911938 + 81 WP_023441679.1 hypothetical protein -
QQG88_RS09115 (1912149) 1912149..1913690 + 1542 WP_001298859.1 IS21-like element ISEc12 family transposase -
QQG88_RS09120 (1913705) 1913705..1914451 + 747 WP_001016257.1 IS21-like element ISEc12 family helper ATPase IstB -
QQG88_RS09125 (1914814) 1914814..1914894 - 81 Protein_1787 hypothetical protein -
QQG88_RS09130 (1914940) 1914940..1915134 - 195 WP_000988601.1 DUF5983 family protein -
QQG88_RS09135 (1915131) 1915131..1915505 - 375 WP_000854814.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
QQG88_RS09140 (1915594) 1915594..1915962 - 369 WP_001546021.1 type IV toxin-antitoxin system cytoskeleton bundling-enhancing antitoxin CbeA Antitoxin
QQG88_RS09145 (1916042) 1916042..1916263 - 222 WP_000692323.1 DUF987 domain-containing protein -
QQG88_RS09150 (1916326) 1916326..1916802 - 477 WP_001186773.1 RadC family protein -
QQG88_RS09155 (1916818) 1916818..1917291 - 474 WP_001385393.1 antirestriction protein -
QQG88_RS09160 (1917554) 1917554..1918375 - 822 WP_001234710.1 DUF932 domain-containing protein -
QQG88_RS09165 (1918596) 1918596..1919006 - 411 WP_000846704.1 hypothetical protein -
QQG88_RS09170 (1919022) 1919022..1919699 - 678 WP_001362823.1 hypothetical protein -
QQG88_RS09175 (1919835) 1919835..1920905 - 1071 WP_000102631.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13898.94 Da        Isoelectric Point: 7.8522

>T297088 WP_000854814.1 NZ_OX637959:c1915505-1915131 [Escherichia coli O25b:H4-ST131]
MKTLPVLPGQAASSRPSPVEIWQILLSRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13607.47 Da        Isoelectric Point: 6.3139

>AT297088 WP_001546021.1 NZ_OX637959:c1915962-1915594 [Escherichia coli O25b:H4-ST131]
VSDTLPGTTLPDDNHDRPWWGLPCTVTPCFGARLVQEGNRLHYLADRASIRGLFSDADAYHPDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCKADTLSSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829FY50

Antitoxin

Source ID Structure
AlphaFold DB A0A641DSP2

References