297085

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 819536..820370 Replicon chromosome
Accession NZ_OX637959
Organism Escherichia coli O25b:H4-ST131 isolate 32

Toxin (Protein)


Gene name yeeV Uniprot ID S1PLF5
Locus tag QQG88_RS03985 Protein ID WP_000854690.1
Coordinates 819536..819913 (-) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID S1P7N8
Locus tag QQG88_RS03990 Protein ID WP_001305076.1
Coordinates 820002..820370 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QQG88_RS03955 (815930) 815930..816100 - 171 Protein_777 IS110 family transposase -
QQG88_RS03960 (816517) 816517..817450 - 934 Protein_778 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QQG88_RS03965 (817443) 817443..817838 - 396 WP_000208384.1 DUF6088 family protein -
QQG88_RS03970 (817907) 817907..818752 - 846 WP_001529401.1 DUF4942 domain-containing protein -
QQG88_RS03975 (818837) 818837..819034 - 198 WP_000839293.1 DUF957 domain-containing protein -
QQG88_RS03980 (819051) 819051..819539 - 489 WP_000761699.1 DUF5983 family protein -
QQG88_RS03985 (819536) 819536..819913 - 378 WP_000854690.1 TA system toxin CbtA family protein Toxin
QQG88_RS03990 (820002) 820002..820370 - 369 WP_001305076.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
QQG88_RS03995 (820420) 820420..821064 - 645 WP_000094916.1 hypothetical protein -
QQG88_RS04000 (821083) 821083..821304 - 222 WP_000692329.1 DUF987 domain-containing protein -
QQG88_RS04005 (821367) 821367..821843 - 477 WP_001186726.1 RadC family protein -
QQG88_RS04010 (821859) 821859..822344 - 486 WP_000849565.1 antirestriction protein -
QQG88_RS04015 (822399) 822399..823217 - 819 WP_001234620.1 DUF932 domain-containing protein -
QQG88_RS04020 (823318) 823318..823551 - 234 WP_000902034.1 DUF905 family protein -
QQG88_RS04025 (823630) 823630..824085 - 456 WP_000581502.1 IrmA family protein -
QQG88_RS04030 (824161) 824161..825288 - 1128 Protein_792 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - kpsT / kpsS / kpsC / kpsU / kpsD / kpsE / kpsF / sat 800862..868582 67720
- flank IS/Tn - - 815930..816085 155


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14057.04 Da        Isoelectric Point: 9.1510

>T297085 WP_000854690.1 NZ_OX637959:c819913-819536 [Escherichia coli O25b:H4-ST131]
MKTLPDTHVRAASRCPSPVTIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYAQVRTDQPGF
SAGAPSQLINSIDILRARRATGLMTRNNYRMVNNITQGKHPEAKR

Download         Length: 378 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13560.39 Da        Isoelectric Point: 4.7830

>AT297085 WP_001305076.1 NZ_OX637959:c820370-820002 [Escherichia coli O25b:H4-ST131]
MSDTLPGTTLPDDNKDLPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHPDQAFPLLMKQPELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCDYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB S1PLF5

Antitoxin

Source ID Structure
AlphaFold DB S1P7N8

References