Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | parDE/RelB(antitoxin) |
| Location | 249170..249782 | Replicon | chromosome |
| Accession | NZ_OX595791 | ||
| Organism | Streptococcus agalactiae isolate MRI Z2-270 | ||
Toxin (Protein)
| Gene name | parE | Uniprot ID | Q8E1X3 |
| Locus tag | QOY19_RS01445 | Protein ID | WP_000384858.1 |
| Coordinates | 249170..249505 (-) | Length | 112 a.a. |
Antitoxin (Protein)
| Gene name | parD | Uniprot ID | Q8E1X2 |
| Locus tag | QOY19_RS01450 | Protein ID | WP_000255538.1 |
| Coordinates | 249495..249782 (-) | Length | 96 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOY19_RS01420 | 244368..245009 | + | 642 | WP_000591144.1 | hypothetical protein | - |
| QOY19_RS01425 | 245309..246184 | + | 876 | WP_000421240.1 | hypothetical protein | - |
| QOY19_RS01430 | 246220..246654 | + | 435 | WP_001220479.1 | hypothetical protein | - |
| QOY19_RS01435 | 246971..248227 | + | 1257 | WP_000122836.1 | MobV family relaxase | - |
| QOY19_RS01440 | 248395..248865 | + | 471 | WP_000130119.1 | hypothetical protein | - |
| QOY19_RS01445 | 249170..249505 | - | 336 | WP_000384858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| QOY19_RS01450 | 249495..249782 | - | 288 | WP_000255538.1 | hypothetical protein | Antitoxin |
| QOY19_RS01455 | 250289..250579 | + | 291 | WP_000078283.1 | WXG100 family type VII secretion target | - |
| QOY19_RS01460 | 250681..251088 | + | 408 | WP_000749954.1 | hypothetical protein | - |
| QOY19_RS01465 | 251088..251648 | + | 561 | WP_001865562.1 | hypothetical protein | - |
| QOY19_RS01470 | 251621..252301 | + | 681 | WP_001865565.1 | hypothetical protein | - |
| QOY19_RS01475 | 252286..252672 | + | 387 | WP_000259069.1 | hypothetical protein | - |
| QOY19_RS01480 | 252706..252987 | + | 282 | WP_000052406.1 | hypothetical protein | - |
| QOY19_RS01485 | 253830..254690 | + | 861 | WP_000477654.1 | Rgg/GadR/MutR family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 241198..250056 | 8858 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 13264.04 Da Isoelectric Point: 5.2388
>T297079 WP_000384858.1 NZ_OX595791:c249505-249170 [Streptococcus agalactiae]
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
MDYKKYQIIYAPDVLEKLKEIRDYISQNYSSTSGQHKMEQIISDIEKLEVFPEVGFDADEKYGSKISKYHSTRGYTLSKD
YIVLYHIEEEENRVVIDYLLPTRSDYMKLFK
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1EF10 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0E1EFF9 |