Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/RelB(antitoxin)
Location 2098136..2098760 Replicon chromosome
Accession NZ_OX465025
Organism Streptococcus agalactiae isolate MRI Z2-329

Toxin (Protein)


Gene name parE Uniprot ID A0A076ZDW1
Locus tag QWI70_RS10585 Protein ID WP_000253103.1
Coordinates 2098136..2098483 (-) Length 116 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A076YVN5
Locus tag QWI70_RS10590 Protein ID WP_000543070.1
Coordinates 2098473..2098760 (-) Length 96 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QWI70_RS10565 2093851..2094207 - 357 WP_000105934.1 DUF1304 domain-containing protein -
QWI70_RS10570 2094274..2096592 - 2319 WP_000883414.1 YhgE/Pip domain-containing protein -
QWI70_RS10575 2096731..2097270 + 540 WP_000245858.1 TetR/AcrR family transcriptional regulator C-terminal domain-containing protein -
QWI70_RS10580 2097356..2097652 - 297 WP_001052249.1 DUF4298 domain-containing protein -
QWI70_RS10585 2098136..2098483 - 348 WP_000253103.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
QWI70_RS10590 2098473..2098760 - 288 WP_000543070.1 type II toxin-antitoxin system RelB/DinJ family antitoxin Antitoxin
QWI70_RS10595 2098829..2099206 - 378 WP_000038826.1 ArpU family phage packaging/lysis transcriptional regulator -
QWI70_RS10600 2099181..2099333 - 153 Protein_2018 DUF1492 domain-containing protein -
QWI70_RS10605 2099340..2099828 - 489 WP_000891151.1 hypothetical protein -
QWI70_RS10610 2099901..2100458 - 558 WP_001258765.1 hypothetical protein -
QWI70_RS10615 2100616..2100789 - 174 WP_000694573.1 hypothetical protein -
QWI70_RS10620 2100786..2101043 - 258 WP_001069293.1 hypothetical protein -
QWI70_RS10625 2101336..2102730 - 1395 WP_000656430.1 VapE family protein -
QWI70_RS10630 2102742..2103599 - 858 WP_001029296.1 primase alpha helix C-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 2092974..2134986 42012


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(12-108)

Antitoxin

RelB antitoxin/Antitoxin DinJ

(7-63)


Sequences

Toxin        


Download         Length: 116 a.a.        Molecular weight: 13333.09 Da        Isoelectric Point: 5.1643

>T297078 WP_000253103.1 NZ_OX465025:c2098483-2098136 [Streptococcus agalactiae]
MVSDNKTHSLIIPETVQEQLQEIKSYIETTYFSEQAGANTVNNILYGLERLEFFPEAGFNADDRVGETIYPPHNTRCIVL
GDYLAFYHILEDRKAVFVSDIIHSKQDYIKLFKKK

Download         Length: 348 bp

Antitoxin


Download         Length: 96 a.a.        Molecular weight: 10605.98 Da        Isoelectric Point: 4.8430

>AT297078 WP_000543070.1 NZ_OX465025:c2098760-2098473 [Streptococcus agalactiae]
MHALEKNTQVNFKTNSDLLEKAKAIIAAQNLDMTASFNLFLENIVQNKALPFETDTDKERAELLAGLRAEIAKSFDDLEH
GRVYNASEVRANLGI

Download         Length: 288 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A076ZDW1

Antitoxin

Source ID Structure
AlphaFold DB A0A076YVN5

References