Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-YefM |
Location | 119027..119598 | Replicon | plasmid SF1039_p1 |
Accession | NZ_OX461118 | ||
Organism | Shewanella baltica strain SF1039 isolate SF1039 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A2I8S8S5 |
Locus tag | QOT06_RS22360 | Protein ID | WP_011918375.1 |
Coordinates | 119287..119598 (+) | Length | 104 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A1Z3MW28 |
Locus tag | QOT06_RS22355 | Protein ID | WP_011787805.1 |
Coordinates | 119027..119287 (+) | Length | 87 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT06_RS22330 | 114401..114820 | + | 420 | Protein_131 | 3'-5' exonuclease | - |
QOT06_RS22335 | 115317..116807 | + | 1491 | WP_011787801.1 | SulP family inorganic anion transporter | - |
QOT06_RS22340 | 116842..117696 | + | 855 | WP_011787802.1 | universal stress protein | - |
QOT06_RS22345 | 117787..118119 | + | 333 | WP_011787803.1 | TraR/DksA C4-type zinc finger protein | - |
QOT06_RS22350 | 118237..118857 | - | 621 | WP_011787804.1 | recombinase family protein | - |
QOT06_RS22355 | 119027..119287 | + | 261 | WP_011787805.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
QOT06_RS22360 | 119287..119598 | + | 312 | WP_011918375.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOT06_RS22365 | 119622..122702 | + | 3081 | WP_011787830.1 | Tn3 family transposase | - |
QOT06_RS22370 | 122756..123211 | + | 456 | Protein_139 | 3'-5' exonuclease | - |
QOT06_RS22375 | 123208..123699 | + | 492 | WP_249555714.1 | hypothetical protein | - |
QOT06_RS22380 | 123781..123891 | + | 111 | WP_283631412.1 | DUF4113 domain-containing protein | - |
QOT06_RS22385 | 123891..124361 | + | 471 | WP_283631413.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..141179 | 141179 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 104 a.a. Molecular weight: 11862.70 Da Isoelectric Point: 8.5341
>T297075 WP_011918375.1 NZ_OX461118:119287-119598 [Shewanella baltica]
MPVTYHLTPDAQSDLIGIHRFTLAQWGTTQSKTYLSGLRQTIQLLAETPTLGKNRPEVRMNVFSFPYSSHVIYYIQHEHQ
FVVFGILHKSMVPLAHLAEREII
MPVTYHLTPDAQSDLIGIHRFTLAQWGTTQSKTYLSGLRQTIQLLAETPTLGKNRPEVRMNVFSFPYSSHVIYYIQHEHQ
FVVFGILHKSMVPLAHLAEREII
Download Length: 312 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2I8S8S5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Z3MW28 |