Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ygfYX/Cpta(toxin) |
Location | 3698747..3699416 | Replicon | chromosome |
Accession | NZ_OX461117 | ||
Organism | Shewanella baltica strain SF1039 isolate SF1039 |
Toxin (Protein)
Gene name | ygfX | Uniprot ID | - |
Locus tag | QOT06_RS15750 | Protein ID | WP_283629749.1 |
Coordinates | 3698747..3699187 (-) | Length | 147 a.a. |
Antitoxin (Protein)
Gene name | ygfY | Uniprot ID | - |
Locus tag | QOT06_RS15755 | Protein ID | WP_006080770.1 |
Coordinates | 3699168..3699416 (-) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT06_RS15725 | 3694223..3694696 | - | 474 | WP_006080776.1 | SoxR reducing system RseC family protein | - |
QOT06_RS15730 | 3694707..3695639 | - | 933 | WP_283629747.1 | MucB/RseB C-terminal domain-containing protein | - |
QOT06_RS15735 | 3695652..3696278 | - | 627 | WP_006080774.1 | RseA family anti-sigma factor | - |
QOT06_RS15740 | 3696320..3696898 | - | 579 | WP_006080773.1 | RNA polymerase sigma factor RpoE | - |
QOT06_RS15745 | 3697089..3698702 | + | 1614 | WP_283629748.1 | L-aspartate oxidase | - |
QOT06_RS15750 | 3698747..3699187 | - | 441 | WP_283629749.1 | hypothetical protein | Toxin |
QOT06_RS15755 | 3699168..3699416 | - | 249 | WP_006080770.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
QOT06_RS15760 | 3699502..3700410 | - | 909 | WP_283629750.1 | transcriptional activator NhaR | - |
QOT06_RS15765 | 3700484..3700870 | - | 387 | WP_006080768.1 | hypothetical protein | - |
QOT06_RS15770 | 3700873..3702042 | - | 1170 | WP_006080767.1 | Na+/H+ antiporter NhaA | - |
QOT06_RS15775 | 3702160..3702954 | - | 795 | WP_011846161.1 | thymidylate synthase | - |
QOT06_RS15780 | 3702951..3703760 | - | 810 | WP_283629751.1 | prolipoprotein diacylglyceryl transferase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 147 a.a. Molecular weight: 17284.29 Da Isoelectric Point: 7.7168
>T297072 WP_283629749.1 NZ_OX461117:c3699187-3698747 [Shewanella baltica]
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLALSLLKYLFIALVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLRRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIQQTKPHTEI
VEDRHHSFSVKASFDQRLSLVVFICVCSSSFLLWPQSDNLALSLLKYLFIALVCIFLLSQLWRLQHWRLDFVLSDKGEGR
LSTGEHFQVLRRTWVTPFVCLMYIEVDTQLRLLMVWADMLDDTDYRHLCRLLLRAKIQQTKPHTEI
Download Length: 441 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|