Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/-
Location 1672788..1673380 Replicon chromosome
Accession NZ_OX461117
Organism Shewanella baltica strain SF1039 isolate SF1039

Toxin (Protein)


Gene name hicA Uniprot ID A0A252ENI2
Locus tag QOT06_RS07325 Protein ID WP_014610888.1
Coordinates 1673126..1673380 (-) Length 85 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID -
Locus tag QOT06_RS07320 Protein ID WP_283628154.1
Coordinates 1672788..1673129 (-) Length 114 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
QOT06_RS07295 1669198..1669440 + 243 WP_220777344.1 nucleotidyl transferase AbiEii/AbiGii toxin family protein -
QOT06_RS07300 1669963..1670208 + 246 WP_014610893.1 type II toxin-antitoxin system CcdA family antitoxin -
QOT06_RS07305 1670208..1670525 + 318 WP_014610892.1 CcdB family protein -
QOT06_RS07310 1670880..1672247 + 1368 WP_283628153.1 HipA domain-containing protein -
QOT06_RS07315 1672244..1672624 + 381 WP_086904820.1 helix-turn-helix transcriptional regulator -
QOT06_RS07320 1672788..1673129 - 342 WP_283628154.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
QOT06_RS07325 1673126..1673380 - 255 WP_014610888.1 type II toxin-antitoxin system HicA family toxin Toxin
QOT06_RS07330 1673780..1674391 - 612 WP_115014218.1 mobile mystery protein B -
QOT06_RS07335 1674388..1674876 - 489 WP_069453178.1 mobile mystery protein A -
QOT06_RS07340 1675081..1675458 + 378 Protein_1428 transposase -
QOT06_RS07345 1676014..1677027 + 1014 WP_283628155.1 dTDP-glucose 4,6-dehydratase -
QOT06_RS07350 1677099..1677275 + 177 WP_197721152.1 tyrosine-type recombinase/integrase -
QOT06_RS07355 1677353..1677517 - 165 WP_014610884.1 hypothetical protein -
QOT06_RS07360 1677539..1678264 - 726 WP_283628156.1 zeta toxin family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 1675009..1675458 449


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(23-75)

Antitoxin

Uncharacterised protein family HicB

(55-104)


Sequences

Toxin        


Download         Length: 85 a.a.        Molecular weight: 9480.99 Da        Isoelectric Point: 10.1453

>T297071 WP_014610888.1 NZ_OX461117:c1673380-1673126 [Shewanella baltica]
MNKKHLRTLTAIFARPVSGAIKWSDIEALFIALGADIEEREGSRIGVVLFGEVQVYHRPHPQKETDKDAVISIKKWLERN
GVKA

Download         Length: 255 bp

Antitoxin


Download         Length: 114 a.a.        Molecular weight: 12379.91 Da        Isoelectric Point: 4.3875

>AT297071 WP_283628154.1 NZ_OX461117:c1673129-1672788 [Shewanella baltica]
MKNLMMINGVKAFIDYDPDAETFRGEFVGLNGGADFYGESVAQLEAEGAKSLTVFLEMCQERGIEPYKNFSGKFNVRISP
DVHARLNEIALSQSISLNAAVENAVNDYIAHSA

Download         Length: 342 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A252ENI2

Antitoxin

Source ID Structure

References