Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | VII | Classification (family/domain) | HepT-MntA/HepT(toxin) |
Location | 1649038..1649869 | Replicon | chromosome |
Accession | NZ_OX461117 | ||
Organism | Shewanella baltica strain SF1039 isolate SF1039 |
Toxin (Protein)
Gene name | hepT | Uniprot ID | - |
Locus tag | QOT06_RS07175 | Protein ID | WP_088585313.1 |
Coordinates | 1649038..1649454 (-) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | mntA | Uniprot ID | - |
Locus tag | QOT06_RS07180 | Protein ID | WP_088585314.1 |
Coordinates | 1649447..1649869 (-) | Length | 141 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT06_RS07165 | 1645249..1647189 | + | 1941 | WP_107948338.1 | nucleoside-diphosphate sugar epimerase/dehydratase | - |
QOT06_RS07170 | 1647264..1648616 | + | 1353 | WP_283628149.1 | phosphoglucosamine mutase | - |
QOT06_RS07175 | 1649038..1649454 | - | 417 | WP_088585313.1 | DUF86 domain-containing protein | Toxin |
QOT06_RS07180 | 1649447..1649869 | - | 423 | WP_088585314.1 | nucleotidyltransferase domain-containing protein | Antitoxin |
QOT06_RS07185 | 1650241..1650501 | + | 261 | WP_115017884.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
QOT06_RS07190 | 1650503..1650850 | + | 348 | WP_283628150.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
QOT06_RS07195 | 1651062..1652270 | + | 1209 | WP_283628151.1 | J domain-containing protein | - |
QOT06_RS07200 | 1653042..1653194 | - | 153 | WP_248943579.1 | hypothetical protein | - |
QOT06_RS07205 | 1653185..1653499 | - | 315 | WP_014610940.1 | hypothetical protein | - |
QOT06_RS07210 | 1653611..1653790 | + | 180 | Protein_1402 | transposase | - |
QOT06_RS07215 | 1654163..1654369 | - | 207 | Protein_1403 | integrase | - |
QOT06_RS07220 | 1654526..1654768 | + | 243 | WP_014610908.1 | type II toxin-antitoxin system ParD family antitoxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 16056.55 Da Isoelectric Point: 7.3244
>T297070 WP_088585313.1 NZ_OX461117:c1649454-1649038 [Shewanella baltica]
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
MNDIIINKIATIKRCIKRIQQVYGDGSMFKQDFTLQDSVILNLQRCCEASIDIANHINRQQQLGIPQSSRDSFTLLSQNK
IINQQLADNLKKMVGLRNIAVHDYQELNLDIVVHVVQHHLEDFEQFIEVIKFCPRMSY
Download Length: 417 bp
Antitoxin
Download Length: 141 a.a. Molecular weight: 15861.89 Da Isoelectric Point: 5.1231
>AT297070 WP_088585314.1 NZ_OX461117:c1649869-1649447 [Shewanella baltica]
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
MQQLNESIIINLLQDNIPQLRLIYLFGSYAQGTQHRNSDIDIAVLADVTLDNIARWQLAQKLASALDTDVDLVDLRTAST
VLCQQVVTQGKRLWGTRQDDEIFAVKTISMYQHLQAERQAIIDDATAKTTANDHRGRHFE
Download Length: 423 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|