Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
| Location | 4030..4611 | Replicon | plasmid EBP3064_p1 |
| Accession | NZ_OX461106 | ||
| Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | - |
| Locus tag | QOT07_RS25195 | Protein ID | WP_283604460.1 |
| Coordinates | 4279..4611 (+) | Length | 111 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | A0A328T8X3 |
| Locus tag | QOT07_RS25190 | Protein ID | WP_041691825.1 |
| Coordinates | 4030..4278 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| QOT07_RS25160 | 1..918 | + | 918 | WP_283604454.1 | plasmid replication initiator RepA | - |
| QOT07_RS25165 | 1491..1733 | + | 243 | WP_000124732.1 | type II toxin-antitoxin system ParD family antitoxin | - |
| QOT07_RS25170 | 1726..2010 | + | 285 | WP_283604457.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
| QOT07_RS25175 | 2073..3017 | - | 945 | WP_283604541.1 | reverse transcriptase family protein | - |
| QOT07_RS25180 | 2983..3300 | - | 318 | WP_064645508.1 | helix-turn-helix transcriptional regulator | - |
| QOT07_RS25185 | 3333..3491 | - | 159 | WP_211271130.1 | hypothetical protein | - |
| QOT07_RS25190 | 4030..4278 | + | 249 | WP_041691825.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| QOT07_RS25195 | 4279..4611 | + | 333 | WP_283604460.1 | endoribonuclease MazF | Toxin |
| QOT07_RS25200 | 4653..4898 | + | 246 | WP_283604462.1 | hypothetical protein | - |
| QOT07_RS25205 | 5082..5309 | - | 228 | WP_283604464.1 | plasmid partition protein ParG | - |
| QOT07_RS25210 | 5349..5969 | - | 621 | WP_283604466.1 | ParA family partition ATPase | - |
| QOT07_RS25215 | 6123..6260 | - | 138 | WP_224718488.1 | hypothetical protein | - |
| QOT07_RS25220 | 6312..6917 | - | 606 | WP_000509966.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | - | - | 1..108855 | 108855 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 111 a.a. Molecular weight: 11953.73 Da Isoelectric Point: 7.1059
>T297068 WP_283604460.1 NZ_OX461106:4279-4611 [Serratia proteamaculans]
MVSRYVPNSADLIWLDFDPVEGHEQGGHRPAVVLSPFSYNNPVGLLLCVPCTTKAKGYPFEVELSGSRESVALADQVTCV
DWRARKVTKKGAVSPEELAEIRAKAKALIG
MVSRYVPNSADLIWLDFDPVEGHEQGGHRPAVVLSPFSYNNPVGLLLCVPCTTKAKGYPFEVELSGSRESVALADQVTCV
DWRARKVTKKGAVSPEELAEIRAKAKALIG
Download Length: 333 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|