Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RelE(toxin) |
Location | 4520676..4521154 | Replicon | chromosome |
Accession | NZ_OX461105 | ||
Organism | Serratia proteamaculans strain EBP3064 isolate EBP3064 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | QOT07_RS21025 | Protein ID | WP_283603858.1 |
Coordinates | 4520676..4520963 (-) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | QOT07_RS21030 | Protein ID | WP_219016928.1 |
Coordinates | 4520963..4521154 (-) | Length | 64 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
QOT07_RS21000 | 4515904..4517184 | - | 1281 | WP_099065286.1 | polysaccharide deacetylase family protein | - |
QOT07_RS21005 | 4517406..4518176 | - | 771 | WP_099065287.1 | ABC transporter permease | - |
QOT07_RS21010 | 4518173..4519096 | - | 924 | WP_085118881.1 | ABC transporter ATP-binding protein | - |
QOT07_RS21015 | 4519333..4519989 | + | 657 | WP_061807929.1 | carbonate dehydratase | - |
QOT07_RS21020 | 4520027..4520563 | - | 537 | WP_012146700.1 | hypoxanthine phosphoribosyltransferase | - |
QOT07_RS21025 | 4520676..4520963 | - | 288 | WP_283603858.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
QOT07_RS21030 | 4520963..4521154 | - | 192 | WP_219016928.1 | stability determinant | Antitoxin |
QOT07_RS21035 | 4521261..4522880 | - | 1620 | WP_283603859.1 | multicopper oxidase CueO | - |
QOT07_RS21040 | 4523117..4523464 | + | 348 | WP_099065294.1 | YacC family pilotin-like protein | - |
QOT07_RS21045 | 4523574..4524437 | + | 864 | WP_099065295.1 | polyamine aminopropyltransferase | - |
QOT07_RS21050 | 4524465..4525259 | + | 795 | WP_099065289.1 | adenosylmethionine decarboxylase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4520676..4529586 | 8910 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10870.62 Da Isoelectric Point: 6.4811
>T297067 WP_283603858.1 NZ_OX461105:c4520963-4520676 [Serratia proteamaculans]
MLAVKWTDEAKTGLYTLIAFIAEQNPVAAESLMQRIEESVIPVTEHPYLFRTGRVAGTREIVVHPNYIVIYRVLAEHIEV
LSVLHARQEYPRTLP
MLAVKWTDEAKTGLYTLIAFIAEQNPVAAESLMQRIEESVIPVTEHPYLFRTGRVAGTREIVVHPNYIVIYRVLAEHIEV
LSVLHARQEYPRTLP
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|